Difference between revisions of "Os02g0622100"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
''LTG1'' '''affects rice growth''' at '''LT''' via an '''auxin-dependent process'''(es)<ref name="ref1"/>.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*A functional nucleotide polymorphism was identified in the coding region of LTG1, causing a single amino acid substitution (I357K) that is '''associated with the growth rate''', heading date and yield of rice plants grown at LT. LTG1 plays an '''important role''' in the '''adaptive growth''' and '''fitness''' of '''rice cultivars''' under conditions of '''low ambient temperature'''<ref name="ref1"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524],
 +
 
 +
===Mutation===
 +
''ltg1'' allele<ref name="ref1"/>:
 +
*Phylogenetic analysis of this locus suggests that the ''ltg1'' haplotype arose before the domestication of rice in tropical climates. LTG1 (Low Temperature Growth 1) allele are '''more tolerant to LT''', than those with the ''ltg1'' allele.  
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The expression of ''LTG1'' is not regulated by temperature, and therefore is unlikely to account for the LT sensitivity. The polymorphism at nucleotide 1070 in LTG1 represents a functional nucleotide polymorphism (FNP) responsible for the LT tolerance of Asominori<ref name="ref1"/>.
 +
 
 +
*Rice cultivars with the dominant ''LTG1'' allele '''fit better''' and had '''higher yield potential''' when grown in environments where low temperatures are present during vegetative and reproductive growth<ref name="ref1"/>.
  
===Evolution===
+
===Knowledge Extension===
Please input evolution information here.
+
*Low temperature (LT), defined as a low but not freezing temperature (>0°C). Apart from water availability, low temperature is the most important environmental factor limiting the productivity and geographical distribution of plants across the world. To cope with cold stress, plant species have evolved several physiological and molecular adaptations to maximize cold tolerance by adjusting their metabolism<ref name="ref2"/>.
  
You can also add sub-section(s) at will.
+
*The regulation of some gene products represents an additional mechanism of cold tolerance. A consequence of these mechanisms is that plants are able to survive exposure to low temperature via a process known as cold acclimation<ref name="ref2"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
 +
*National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Kim I S, Kim Y S, Yoon H S. Rice ASR1 protein with reactive oxygen species scavenging and chaperone-like activities enhances acquired tolerance to abiotic stresses in Saccharomyces cerevisiae[J]. Molecules and cells, 2012, 33(3): 285-293.
 +
</ref>
 +
* <ref name="ref2">
 +
Theocharis A, Clément C, Barka E A. Physiological and molecular changes in plants grown at low temperatures[J]. Planta, 2012, 235(6): 1091-1105.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:06, 12 March 2015

LTG1 affects rice growth at LT via an auxin-dependent process(es)[1].

Annotated Information

Function

  • A functional nucleotide polymorphism was identified in the coding region of LTG1, causing a single amino acid substitution (I357K) that is associated with the growth rate, heading date and yield of rice plants grown at LT. LTG1 plays an important role in the adaptive growth and fitness of rice cultivars under conditions of low ambient temperature[1].

GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524,

Mutation

ltg1 allele[1]:

  • Phylogenetic analysis of this locus suggests that the ltg1 haplotype arose before the domestication of rice in tropical climates. LTG1 (Low Temperature Growth 1) allele are more tolerant to LT, than those with the ltg1 allele.

Expression

  • The expression of LTG1 is not regulated by temperature, and therefore is unlikely to account for the LT sensitivity. The polymorphism at nucleotide 1070 in LTG1 represents a functional nucleotide polymorphism (FNP) responsible for the LT tolerance of Asominori[1].
  • Rice cultivars with the dominant LTG1 allele fit better and had higher yield potential when grown in environments where low temperatures are present during vegetative and reproductive growth[1].

Knowledge Extension

  • Low temperature (LT), defined as a low but not freezing temperature (>0°C). Apart from water availability, low temperature is the most important environmental factor limiting the productivity and geographical distribution of plants across the world. To cope with cold stress, plant species have evolved several physiological and molecular adaptations to maximize cold tolerance by adjusting their metabolism[2].
  • The regulation of some gene products represents an additional mechanism of cold tolerance. A consequence of these mechanisms is that plants are able to survive exposure to low temperature via a process known as cold acclimation[2].

Labs working on this gene

  • National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China

References

  1. 1.0 1.1 1.2 1.3 1.4 Kim I S, Kim Y S, Yoon H S. Rice ASR1 protein with reactive oxygen species scavenging and chaperone-like activities enhances acquired tolerance to abiotic stresses in Saccharomyces cerevisiae[J]. Molecules and cells, 2012, 33(3): 285-293.
  2. 2.0 2.1 Theocharis A, Clément C, Barka E A. Physiological and molecular changes in plants grown at low temperatures[J]. Planta, 2012, 235(6): 1091-1105.

Structured Information

Gene Name

Os02g0622100

Description

Similar to Dual specificity kinase 1

Version

NM_001054000.1 GI:115447370 GeneID:4330018

Length

5942 bp

Definition

Oryza sativa Japonica Group Os02g0622100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:25624670..25630611

Sequence Coding Region

25625185..25625260,25625393..25625433,25626522..25626591,25626665..25626813,25626959..25627054
,25627681..25627751,25628347..25628408,25628643..25628706,25628794..25628878
,25628983..25629109,25629182..25629243,25629331..25629391,25629482..25629615
,25629823..25630116

Expression

GEO Profiles:Os02g0622100

Genome Context

<gbrowseImage1> name=NC_008395:25624670..25630611 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:25624670..25630611 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcatgtgatcggggggaagtttaagctggggaggaagattgggagcggatcttttggggagctataccttggtgtgaatatacagagcagcgaggaggtagccatcaagttggaatctgtaaaatcaaggcatcctcagcttcattatgagtcaaaactatacatgcttctgcaggggggaactggaattcctcatctgaagtggtttggagtggagggggagtacaatgtcatggttatcgatcttcttggtccaagtttagaggacttattcaactactgcaacagaaagttttctcttaaaacagtacttatgcttgctgatcagatgatcaacagggtagagtacatgcacactagggggtttctacatcgtgatatcaagccagacaacttccttatgggtttaggccgcaaagcaagccaggtttatgtcatcgactatggtcttgcaaagaaataccgggacctccaaactcataagcatataccttacagggagaacaaaaatctcacaggaacagcacgctatgctagtgtaaacacccatcttggagtagaacaaagcaggagagatgatttagagtctctgggctatgtgcttatgtatttcttaagaggaagccttccttggcaaggtctaaaagctggcacaaaaaaacagaaatatgacaaaattagtgaaaagaaaatgcttactccagttgaggttctctgtaaatcttatcccacagagttcatttcatacttccattactgtcgatctttgcgatttgaagataaaccagactacagctatttgaagagacttttccgagatctattcatccgtgaagggtaccagcttgattatatatttgattggacgaagcaaggttcagaaagtaacagattgcgatcaagtggaaggacaagtgggttggtgggaccatctgcagaacggactgaacgagctgcagcaagacaggatgttcctgacagattctctggtacagtcgatccatttgctagaagaactggctctggttctggccattacggagagcacacaaagcacagaaatatattggattcattacttgcacccaagacggctgttgatttagataaaagaaggcccacatcatcatctcgtaatgggagcacatcaaggaaggctctcttgtcaagcagcagaccaagttctggagatcccattgatccgaaccgcagtaacctaattccaaccagcagtggcagcagtcgcccatcaactatgcagaggcttcaccagtcaacaggacttgagaccaggtcctcgcttaccaaaactgcaagaaatgtccatgatgatcccactttgaggacctttgaacgcctttcaatcagtgctgacagaaggaaataa</cdnaseq>

Protein Sequence

<aaseq>MEHVIGGKFKLGRKIGSGSFGELYLGVNIQSSEEVAIKLESVKS RHPQLHYESKLYMLLQGGTGIPHLKWFGVEGEYNVMVIDLLGPSLEDLFNYCNRKFSL KTVLMLADQMINRVEYMHTRGFLHRDIKPDNFLMGLGRKASQVYVIDYGLAKKYRDLQ THKHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKA GTKKQKYDKISEKKMLTPVEVLCKSYPTEFISYFHYCRSLRFEDKPDYSYLKRLFRDL FIREGYQLDYIFDWTKQGSESNRLRSSGRTSGLVGPSAERTERAAARQDVPDRFSGTV DPFARRTGSGSGHYGEHTKHRNILDSLLAPKTAVDLDKRRPTSSSRNGSTSRKALLSS SRPSSGDPIDPNRSNLIPTSSGSSRPSTMQRLHQSTGLETRSSLTKTARNVHDDPTLR TFERLSISADRRK</aaseq>

Gene Sequence

<dnaseqindica>516..591#724..764#1853..1922#1996..2144#2290..2385#3012..3082#3678..3739#3974..4037#4125..4209#4314..4440#4513..4574#4662..4722#4813..4946#5154..5447#ggggtacccataatctccacatcctcctcctcccacctctactccggccaccggccgcctcctcccacgctccccccgccgccgccgccgccgccgccgccgccatcgccacccgcctcctccttctagcagtagtaataaaggaaggaagaaaatccaccgccctacccctatctatccgttgcctcacgtccgtttcccacattttccgcttccttcgtccatcgccatctattaacccgcccccccacgattcctgccgagaaatttctcccccccacagagagggaggcgatccctagcctcgtcctgaatctcgcggcgccgccaattcgatctgcccgcgccgtctcagggcggcgaatcttgggctggagtcggggggagagatccgggatcttccttttcttgggtgttcccgggacgcaaatcttgcggccgccgggcaatgtgactggggttcttgtggggggtgaggcgattcgcgcgcgcattcggtgctgaatcttgcggggatggagcatgtgatcggggggaagtttaagctggggaggaagattgggagcggatcttttggggagctataccttggtacgttcctcgtggggttctcggatctctcgtctatcgccgctcgttgcgaggcaccgttcgtttttcttcttcttactgtttacgctgtttgtgatgatgtcgttgattcatggattgtttcgattacaggtgtgaatatacagagcagcgaggaggtagccatcaagttggtatgtgaagatgatttcgtttctgatatataagccttttcttacgccaatgtatatattgtagtaattagtattgcattggtttcttttgtgctgatgttgtgatgcgaatatggtttgttctgccctcctagaaaagattagatcacctgaggtgtaacagagtttgcattgctgcatgatcagaaatttgaatgaagctacatgtatacgtccttgtgaaatcgttgacatgacctcttgcttagtatcatactctttcatacaagtagaaaccaggtcttctaaatttttttggttctccgacctaactggtctattagagatgttcagaattgggaagtaagaaaaaagaggtgaagatttttcagcttccaattggatcgttgacattatttaattgcttcatctaggtgatgtgtgtggtttacgagagcacttattctgaaacatctgtaaataacatgaggcagcccaccaacccttgtcatactatattatctgctcttgtaacattaggactcagggcagccgcccgtgattctgttcacatcctgtaagacctgcaaacaaagcttttccgtctggggaaacgaagccttttggaataccttgtgcatgttttggctaggttgggtagctgtgaagcattggttattgtctatttcaatgtttcaaagcagcattcaaggattctcctgatattattgctccggttcagtggtcaatgcacttcttttagaagcttctattatttcgatatgattgttagtagtttggtcacatctacttttcaagcaacttaccttgtaagttcacgtagttgctagttttgtgaaccagctttgcctttctaatcatgaatgccatttctatattgtaagcctgtatgcattggattgctttcttaaatggtgcaatccttgttctatgagaaaatgttggtaataatgaaaataaggtgttcggaaacttggaaagtgtatttctatattgacatgaatagtcactgtcagcactgattacttgtccttgctgacactgggacaaattacctaaaccttttctgtcatctcttattttgttaggaatctgtaaaatcaaggcatcctcagcttcattatgagtcaaaactatacatgcttctgcaggggggaagtaagtgtaatacgggaaactgtttatctatttaaataaaattgttcacttattatgtcttggttatgttcagctggaattcctcatctgaagtggtttggagtggagggggagtacaatgtcatggttatcgatcttcttggtccaagtttagaggacttattcaactactgcaacagaaagttttctcttaaaacagtacttatgcttgctgatcagatggtgggtttttcttactgaattctattattttggctgttaattttggttacctgtatgactaaatttcaataaattaacgatcaaggaaagtaaatttcaagactttatttgtctgatttaaccactaacttcctgttctatacagatcaacagggtagagtacatgcacactagggggtttctacatcgtgatatcaagccagacaacttccttatgggtttaggccgcaaagcaagccaggtttgtcccattcatctgcagttgctggtagatataattcattatttttctgcgctttggatgttgttggttgcctggtctgtataattttgtattgataacatcttgattcgagtatttggcctggtttctaagtatcatcttttttggtgctatgaagttttgtcaattggcagtagtatcttcaattatactttctaagagaggctatgatattaccaacaacagctgtcagctgtgctctgtgtgcttgatgattatactagtttctttatggagaaattatcttgtataataaattttagtattttttagaaacatcttttttatgaatgtagaaagactttggagaatttaaactgctgactgtgatcatcgatttaccatacgttttattatttcgtaagaacttgaagaatacaaggataatatttctgttttctcttatttgtgcatactgttactcagcatatgcatatcaactgcctttctagtactgctgctaactgatgatcgaaagcctgcatttacttcatatgtgatatatcttacaatgaataacatcaagaaataagcacaactttttgtagacattgttgtgagtgatctttacaattctgtaacaggtttatgtcatcgactatggtcttgcaaagaaataccgggacctccaaactcataagcatataccttacaggtaattagaaattcttctctagtaaatgttttagaaagtatttatgtttacacctggaagattgttgtagtagagcactcagcttatgaaaaatcatactaaagtatattgttttggtagcaacaccgtttttatctgacagagctcaaagtgcttaatttagaatttttcattaccataactgtgcttggcacactaccggtggagcagtatctgctattaaccatattggcaagcagtatctgctattaactatatagataagcccacacaattttgttatctgtttttacttcttgaaattaagagaaatgcttgatagtagtgagtaatgacagcagcattgcaacaatttgatcaatgatgattgtgataattgataaaccattttctgttatgttttagtactatactgtgacattggtcagtaacacgggttacactatcactattcactacttagcagttacctccttcatactaatagtaaaaagtttaccagtttatctaccattatatttctatgcatgattatgcttcatacttttctggggatatatgtttgaagcttacatgtttttctttcctaccatagggagaacaaaaatctcacaggaacagcacgctatgctagtgtaaacacccatcttggagtaggtaagtgtctttacctgttactgattcgttttcatcagaagagattttattttttaaaaatctgaactaacgcaaactaatatgtatttaagaggtgcaaaatgtggcaacactgaaaagttatgaacaagtgtagctcctttgaaacaaataaagtttagcttgcaacaaaattagtcaattgcactctgactgctagtatatgcgttcttttaattctgtttttcactacagaacaaagcaggagagatgatttagagtctctgggctatgtgcttatgtatttcttaagaggaaggtgagacgatgcttgttttctattttttaaaattccattttatacgacaatacattttattgatctatgttaacttgtccatctcagccttccttggcaaggtctaaaagctggcacaaaaaaacagaaatatgacaaaattagtgaaaagaaaatgcttactccagttgaggtaatggaaattggtttccatgcaaaaaaaatctatgaagaagcatgacattttttgatttaattgcaacttaaccttatcatattttacacaattttgtataggttctctgtaaatcttatcccacagagttcatttcatacttccattactgtcgatctttgcgatttgaagataaaccagactacagctatttgaagagacttttccgagatctattcatccgtgaaggtatgctcaaatataatacaatgaagtatctctgcatacacatctaaaatgatttcctctcaattcttgcagggtaccagcttgattatatatttgattggacgaagcaaggttcagaaagtaacagattgcgagtatgtctgctattcctttttctaactttttttggtaatgcaaagctttaccgtactaaatgtgtagcatcttttccttgcttccagtcaagtggaaggacaagtgggttggtgggaccatctgcagaacggactgaacgagctgcaggtttgtcagtagcatagacattttttgaatttatatttaggaaataagtttggaaaataacaggggttttttggggtgttgtctcaacagcaagacaggatgttcctgacagattctctggtacagtcgatccatttgctagaagaactggctctggttctggccattacggagagcacacaaagcacagaaatatattggattcattacttgcacccaagacggtaagaaattgagcagctagatcaccttctagcagtatcctaaaaaaactgctcaaattagcaggataatgagacggatgtttcttcgttagtcttgaccatcttttcgcagaaatcttttgttgtgtttttacattacgttgctgttgatgatagctggaactctgtattctggaaggcttatgtcaattttaccatgcgtgctaggctgttgatttagataaaagaaggcccacatcatcatctcgtaatgggagcacatcaaggaaggctctcttgtcaagcagcagaccaagttctggagatcccattgatccgaaccgcagtaacctaattccaaccagcagtggcagcagtcgcccatcaactatgcagaggcttcaccagtcaacaggacttgagaccaggtcctcgcttaccaaaactgcaagaaatgtccatgatgatcccactttgaggacctttgaacgcctttcaatcagtgctgacagaaggaaataatgcttcgaagagcaaaagatgtgagttgctgctccagtgaggacactggggattccttcacacgatgattactgatcaacaagtaaaaaccattctgtgctacagatgatgctgagatatgcttaagagtgaagtttgcttactgaatcttggcgcaaaagaaatggttaaagaaatcattttacacgccattcagaagaacccggaccagcaactgtgctggtccaattaatgctgatgttgatcaaatatttgtagaaatgttattgaaataaagcagttcattactagcaaaatatgtactatcacgtagtatttcctttgtgcactgcaactagaacttctgccactctgccactatactcttaagataatcaatatccttttttgccttagtgccctttagatactccgtcacattatttccttaaaaacttggagatcatgtaatcgttattaatatatcatacgatcagatatcgttattcaactagc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0622100, RefSeq:Os02g0622100