Difference between revisions of "Os01g0248900"
(→protein 3D structure) |
(→Structured Information) |
||
| Line 51: | Line 51: | ||
==Structured Information== | ==Structured Information== | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
[[Category:Genes]] | [[Category:Genes]] | ||
[[Category:Japonica mRNA]] | [[Category:Japonica mRNA]] | ||
Revision as of 07:07, 13 May 2015
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. =RNA coding sequence= /translation="MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG
ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN
FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF
AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF
RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY"
ORIGIN
1 gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg
61 ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac
121 gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg
181 acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc
241 ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc
301 gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg
361 tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg
421 taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc
481 atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc
541 ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg
601 agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg
661 ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg
721 tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca
781 agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga
841 cgtggcatag gatggaagag gccgcccacg aagaaaattt gggacttgtg tat
protein 3D structure
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
