|
|
| Line 20: |
Line 20: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]] |
| − | GeneName = Os05g0180800|
| |
| − | Description = Protein of unknown function DUF1070 family protein|
| |
| − | Version = NM_001187316.1 GI:297723762 GeneID:9271464|
| |
| − | Length = 141 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os05g0180800, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
| |
| − | AP = Chromosome 5:4851585..4851725|
| |
| − | CDS = 4851585..4851725|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008398:4851585..4851725
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008398:4851585..4851725
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaggacttcggcggcggcggcggaggcggcgccgcggcggctgcggcggcggatcgccgtcgaccgcggcgtggtggaccaggcggtggcgtacacgctcatggccgccgcgctcgccgtcacctacctcgtgcactga</cdnaseq>|
| |
| − | AA = <aaseq>MRTSAAAAEAAPRRLRRRIAVDRGVVDQAVAYTLMAAALAVTYL VH</aaseq>|
| |
| − | DNA = <dnaseqindica>1..141#atgaggacttcggcggcggcggcggaggcggcgccgcggcggctgcggcggcggatcgccgtcgaccgcggcgtggtggaccaggcggtggcgtacacgctcatggccgccgcgctcgccgtcacctacctcgtgcactga</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187316.1 RefSeq:Os05g0180800]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 5]]
| |
| − | [[Category:Chromosome 5]]
| |
Latest revision as of 08:21, 14 May 2015
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information