|
|
| Line 24: |
Line 24: |
| | [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052. | | [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052. |
| | | | |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os12g0100500|
| |
| − | Description = Alpha/beta hydrolase family protein|
| |
| − | Version = NM_001071764.1 GI:115486849 GeneID:4351238|
| |
| − | Length = 1294 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os12g0100500, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
| |
| − | AP = Chromosome 12:11806..13099|
| |
| − | CDS = 11806..12363,12659..13099|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008405:11806..13099
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008405:11806..13099
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</cdnaseq>|
| |
| − | AA = <aaseq>MSSSSGGDGGGYNYSEDWVVNSRGMRLFTCAWIPKESSRGVVCL CHGYAVECSVTMRGTAERLARAGYAVHGIDYEGHGHSDGLQGYVPDLDALVRDCDSFF STATASFPRRRFLLGESMGGAVALLLHRLRPDFWTGAILVAPMCKIAEEMRPHPMVVS VLKVMTSIIPTWRVVPTNDVIDLAYRMQGKRDEIRGNPLCYKGRPRLKTAYELLRVSI LIESTILPHVSLPFLILHGAADRVTDPSVSDLLYRSASTTDKTFHLYTGMWHALTSGE LPHNIDAVFRDIIDWLHHRTSPTSASHVQDHDLSTSFEAERKAKHDDTIHCGKQTS</aaseq>|
| |
| − | DNA = <dnaseqindica>737..1294#1..441#atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaaggtccgttcaactccatcttaacctttgactctgacttttcctttttctttttgcccgccacatgcatgccatccacgaatcattcagtctacatatgcgtccccaagattagattagatatttagattatactacataacagaacaggctgtctctttctcattttctaagctacctaccggccggccactttcagattattatcttcttttaacgcaacgcaaggaaacgtttctgactgcctcaaatatcatggatgcatgtggttgaatactagtaaaatgcgtggttgcagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071764.1 RefSeq:Os12g0100500]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Revision as of 04:29, 12 June 2015
Please input one-sentence summary here.
Annotated Information
Os12g0100500 in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein [Hordeum vulgare subsp. vulgare]. This gene is predicted to be coding Lysophospholipase [Lipid metabolism]; COG2267.
Function
In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
2-lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate
Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate.
This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008. Phospholipase B enzymes catalyse the release of fatty acids from lysophospholipids and are capable in vitro of hydrolyzing all phospholipids extractable from yeast cells.[1] Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca2+ and selectively hydrolyses arachidonyl phospholipids,[2] the aligned region corresponds the carboxy-terminal Ca2+-independent catalytic domain of the protein as discussed in.[2]
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
[1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
[2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.
