|
|
| Line 28: |
Line 28: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os09g0106700|
| |
| − | Description = Similar to Myb proto-oncogene protein (C-myb)|
| |
| − | Version = NM_001069097.1 GI:115477933 GeneID:4346379|
| |
| − | Length = 1586 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0106700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:603500..605085|
| |
| − | CDS = 604001..604960|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:603500..605085
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:603500..605085
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaa</cdnaseq>|
| |
| − | AA = <aaseq>MMASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLIS KSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRT DNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSH HSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPH PDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLA MMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE</aaseq>|
| |
| − | DNA = <dnaseqindica>126..1085#ctgacttaatttagctccgcctccattcacgcattcacactagcatagcatataagatagcacttgtagagaggagatactagtacacatagagaagaggagaggagattgatcggtgagggaggatgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaatcaaccagccgcagcagcatacggaatgatcgagtaatcaagctcagattgatgcactgcaagcaagaaagcagagcaagaagcagaggcgccggcgcggcaagtgaagagacgacgaccatcaacgtttggatcctccttttctattctgctatagtcttcttcttccccaataattccttgtctagttttaatttttttttctcttcaatttttactcctccaatccaagttgaagttgtcactagtagagttctccagagagagaggagatgaagcaacaacaaggagctgtgtctgcctgtctggaggaactaataccaaaccaaaataagcagagtgtgtgctgctgtgccacaatcagcaccaccaccgtggcaccacccactagcttagcttagctagctagttcaaagttctttttgtatatacttataagaggaaaaagaaaaaagagagctgatcagtgaaaattcagaatgcatcagtgaagagaattgc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069097.1 RefSeq:Os09g0106700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Revision as of 09:37, 12 June 2015
Please input one-sentence summary here.
Annotated Information
Function
- PutAKT1 is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in P. tenuiflora , even under saltstress condition.The notion that AKT1-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of AKT1-disrupted mutants.
- PutAKT1 not only increases tissue K+ accumulation, but also decreases Na+[1].
Expression
- The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.
- Expression of PutAKT1 increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.
- The expression of PutAKT1 was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing PutAKT1 showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.
- Expression of PutAKT1 also showed a decrease in Na+ accumulation both in the shoot and in the root.
Expression in experiment
Subjected to NaCl and K+-starvation stresses for 24 h, PutAKT1 was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, PutAKT1 expression was monitored over a 24-h period.
level of PutAKT1 is down-regulated by excessive external NaCl. Under K+-starvation stress, PutAKT1 was dramatically induced at 24 h of stress.
Evolution
- PutAKT1 belongs to the AKT1-subfamily in the Shaker K+ channel family. PutAKT1 was localized in the plasma membrane and it was preferentially expressed in the roots.there are three AKT1-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that PutAKT1 belongs to a small gene family.
Labs working on this gene
- Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan
- Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu
- Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China
References
- Sintho Wahyuning Ardie. Shenkui Liu. Expression of the AKT1-type K+ channel gene from Puccinellia tenuiflora, PutAKT1, enhances salt tolerance in Arabidopsis. Plant Cell Rep (2010) 29:865–874. DOI 10.1007/s00299-010-0872-2
Structured Information
- ↑ Cite error: Invalid
<ref> tag;
no text was provided for refs named ref_1