Difference between revisions of "Os03g0135700"
(→References) |
(→Evolution) |
||
| Line 12: | Line 12: | ||
The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins . | The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins . | ||
| − | ==Labs working on this gene | + | ==Labs working on this gene== |
| − | + | * Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan | |
| − | + | * Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan | |
| − | Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan | + | * Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan |
| − | + | * Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan | |
| − | Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan | ||
| − | |||
| − | Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan | ||
| − | |||
| − | Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
==References== | ==References== | ||
Revision as of 06:13, 8 March 2017
Please input one-sentence summary here.
Contents
Annotated Information
Function
The Rac/Rop GTPase OsRac1 plays an essential role in rice immunity.the gene RAP1 encodes a putative basic helix–loop–helix transcription factor and thhis factor acts as the first factor downstream of the OsRac1,it can induce the expression of the PAL1 and OsWRKY19 by the mechanism of interacting with the OsMKK4–OsMAPK3/6 cascade,which result in the enhancement of the immunity to the rice blast fungus.
===Expression
We used fluorescent proteins to examine the subcellular localization of RAI1 in rice protoplasts isolated from cultured cells. The protoplasts were transfected with either a fluorescent RAI1–green fluorescent protein (GFP) construct or the control fluorescent protein GFP, and then examined under a confocal microscope. RAI1–GFP accumulated mainly in the nucleus but slightly in the cytoplasm, whereas GFP was distributed throughout the cytoplasm and nucleus.this implies that this gene may be a translation factor .when the rice was treated with the sphingolipid and chitin elicitors,we can observe the elevation of this gene's expression level ,and the response is more instant than the PAL1 and OsWRKY19 ,with the addition of other expeiments,we can conclude that this gene act as the first factor downstream of theOsRac1 and induce the expression of the PAL1 and OsWRKY19,two essential genes in the plant immunity.
Evolution
The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins .
Labs working on this gene
- Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan
- Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan
- Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan
- Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
References
Please input cited references here. [1] [2] [3] [4]
Structured Information
| Gene Name |
Os03g0135700 |
|---|---|
| Description |
Basic helix-loop-helix dimerisation region bHLH domain containing protein |
| Version |
NM_001055424.2 GI:297600285 GeneID:4331538 |
| Length |
1998 bp |
| Definition |
Oryza sativa Japonica Group Os03g0135700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:1961902..1963899 |
| Sequence Coding Region |
1961902..1962100,1962234..1962310,1962516..1962686,1962871..1963047,1963190..1963819 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:1961902..1963899 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:1961902..1963899 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</cdnaseq> |
| Protein Sequence |
<aaseq>MELDEESFLDELMSLRRDGSAPWQAPPYPGGGGGGGGGGMMMSD LLFYGGDGGSAEARGGMDASPFQELASMAAPPPQHPHEEFNFDCLSEVCNPYRSCGAQ LVPSEAASQTQTQLTPLRDAMVAEEETSGDKALLHGGGGSSSPTFMFGGGAGESSEMM AGIRGVGGGVHPRSKLHGTPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILG DTIDYVKELTERIKTLEEEIGVTPEELDLLNTMKDSSSGNNNEMLVRNSTKFDVENRG SGNTRIEICCPANPGVLLSTVSALEVLGLEIEQCVVSCFSDFGMQASCLQEDGKRQVV STDEIKQTLFRSAGYGGRNYSRSSTIYEFIFISSGSTSFLNTPESKLKICSSIVSFAF VNRYGNRPCDLSNIGFELNAKVPIVC</aaseq> |
| Gene Sequence |
<dnaseqindica>1800..1998#1590..1666#1214..1384#853..1029#81..710#ggagaggtgactgctagcgaggaaagggagcatatatactactatagcttagcttgctgcaggtgctagctagctgaggcatggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaaggtgacacacacattgatttgtattgttgtcttgtgacctaattaattgacctagctagctgtagctagcttcttgtctccgtgtcccgtgtgctcatatatctgtaattaaacaatcaatcaatcgctcgctcgcgctgcagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaaggtacgtacctagcttagctacgcaggcaagcatcgcatcgatggagttttagtttggcatgtatgtatgtgcttgtatatttcttgtgcgtccgcgcagctaaattaatctggttgttgcgatcgaactttgtgatgcatggggcgaaactaactaattaaactgcggtttgattttcctccagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagtaagttctatatatctatcttgaattcttgatagctatagcaacttagctagtgcggatttctgaacatctatatcggtcgatatatagctataccttgatttcttgctcgaacaaattaacctatagctatatataggcatatatatgttttgattaatctcttgtttcaatattgaatgggttcgtcgacaatgcatgataggaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggtgtctgtagctagctagctatacaatccattgaacgctgagcactgtgagcaggtacaggttgcatatatatgatcttcatcatccatgatataggagtaatagctatacatgcatatgcacttcgctccaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</dnaseqindica> |
| External Link(s) |
- ↑ Andreasson, E., Jenkins, T., Brodersen, P., Thorgrimsen, S.Petersen, N.H., Zhu, S. et al. (2005) The MAP kinase substrate MKS1 is a regulator of plant defense responses. EMBO J. 24:2579–2589.
- ↑ Atchley, W.R., Terhalle, W. and Dress, A. (1999) Positional dependence,cliques, and predictive motifs in the bHLH protein domain. J. Mol. Evol. 48: 501–516.
- ↑ Berken, A. (2006) ROPs in the spotlight of plant signal transduction.Cell. Mol. Life Sci. 63: 2446–2459
- ↑ Chisholm, S.T., Coaker, G., Day, B. and Staskawicz, B.J. (2006) Host–microbe interactions: shaping the evolution of the plant immune response. Cell 124: 803–814.
