Difference between revisions of "BGIOSGA009015"
(Created page with "{{IndicaGene|
GeneName = BGIOSGA009015|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA009015, complete gene.|
tag = P0487D0...") |
|||
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
{{IndicaGene| | {{IndicaGene| | ||
GeneName = BGIOSGA009015| | GeneName = BGIOSGA009015| | ||
Revision as of 18:54, 20 July 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA009015 |
|---|---|
| Description |
Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA009015, complete gene. |
| LocusTag |
P0487D09.35 |
| Ensembl Transcript ID |
BGIOSGA009015-TA |
| Ensembl Protein ID |
BGIOSGA009015-PA |
| Length |
279 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:32770252..32770530 |
| Sequence Coding Region |
32770252..32770530 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome02:32770252..32770530 source=RiceIndica02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome02:32770252..32770530 source=RiceIndica02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGCGCTAGTGGATCGCGAGGGCGATGGAGACCTTGGCGAGGAGTGCGAGGGAGGAGAGGAGAGGCCTCGGCGCCGGCAGCAACGGGGAGCGCCAGTAGAAGAAGCGGCGCCGCAGCGGGCGGAGGACGGCGTCGAGGAGGCACGACGAGATCACCCTCGACGCCGCCCCGACCTCACCGACGCCGTGCCATCGTCGTCCACCTCGGCCGCCGGAGACGACGACGACGACCCCTTCCTCCTAGCTGGCTTCATCTCCATGCTCTTGGACTTCTCCTAA</cdnaseq> |
| Protein Sequence |
<aaseq>MALVDREGDGDLGEECEGGEERPRRRQQRGAPVEEAAPQRAEDGVEEARRDHPRRRPDLTDAVPSSSTSAAGDDDDDPFLLAGFISMLLDFS</aaseq> |
| Gene Sequence |
<dnaseqindica>1..279#ATGGCGCTAGTGGATCGCGAGGGCGATGGAGACCTTGGCGAGGAGTGCGAGGGAGGAGAGGAGAGGCCTCGGCGCCGGCAGCAACGGGGAGCGCCAGTAGAAGAAGCGGCGCCGCAGCGGGCGGAGGACGGCGTCGAGGAGGCACGACGAGATCACCCTCGACGCCGCCCCGACCTCACCGACGCCGTGCCATCGTCGTCCACCTCGGCCGCCGGAGACGACGACGACGACCCCTTCCTCCTAGCTGGCTTCATCTCCATGCTCTTGGACTTCTCCTAA</dnaseqindica> |
| External Link(s) |