Os01g0136200
OsHsp17.0 is a member of Heat shock proteins(Hsps), it belongs to sHSP family[1][2].
Contents
Annotated Information
Function
OsHsp17.0 and OsHsp23.7 play an important role in rice acclimation to salt and drought stresses and are useful for engineering drought and salt tolerance rice. Heat shock proteins (Hsps) play an important role in plant stress tolerance[1].
The transcripts of OsHSP80.2, OsHSP74.8, OsHSP26.7 and OsHSP17.0 were increased rapidly and kept at constantly high levels during the heat stress[2].
Mutation
- Three highly over-expressed lines in transgenic lines[1]:
- OsHsp17.0-OE#1
- OsHsp17.0-OE#3
- OsHsp17.0-OE#8
- Both OsHsp17.0-OE and OsHsp23.7-OE transgenic lines demonstrated higher germination ability compared to wild-type (WT) plants when subjected to mannitol and NaCl.
- Phenotypic analysis showed that transgenic rice lines displayed a higher tolerance to drought and salt stress compared to WT plants.
- Transgenic rice lines showed significantly lower REC, lower MDA content and higher free proline content than WT under drought and salt stresses.
Expression
- However, after recovery for 10 d, the survival rates of OsHsp17.0-OE and OsHsp23.7-OE transgenic plants (about 30–41%) were much higher than that of the control plants (only12.5%), which suggesting that overexpression of OsHsp17.0 and OsHsp23.7 in transgenic rice enhanced drought tolerance[1].
- Also, the overexpression of OsHsp17.0 and OsHsp23.7 can improve salt resistance of transgenic rice[1].
- After temperature treatment, leaf tips of both transgenic plants and WT plants were rolled or withered, no significant differences were observed between them. After recovery for 7 d, both transgenic plants and WT plants remained alive and produced new leaves[1].
- Transcripts of OsHSP80.2, OsHSP74.8, OsHSP71.1, OsHSP26.7, OsHSP24.1 and OsHSP17.0 were increased 5min after the onset of heat treatment[2].
- OsHSP17.0, OsHSP26.7 and OsHSP24.1 were predominantly expressed in spikes and/or imbibed seed embryos.They would play certain roles in pollen development and seed germination[2].
Evolution
Gene tree were conducted using the software Molecular Evolutionary Genetics Analysis (MEGA) Version 4.0 by the neighbor-joining method with pairwise deletion and the Poisson correction model. As shown in Figure 1, based on amino acids sequence homology, nine OsHSP genes were divided into three classes, among them OsHSP80.2, OsHSP74.8 and OsHSP50.2 belong to HSP90 family; OsHSP71.1, OsHSP58.7 and OsHSP23.7 belong to HSP70 family; OsHSP26.7, OsHSP24.1 and OsHSP17.0 belong to sHSP family[2].
Knowledge Extension
Heat shock proteins (Hsps) belong to a class of proteins that are conserved in prokaryotes and eukaryotes and are especially abundant in plants. Hsps are highly expressed in plants and other organisms after being stimulated by high temperature and other stresses. The sHsps are much more abundant in higher plants than in other organisms[3]. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses[2]. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs, o40 kDa)[4]. Most HSPs function as molecular chaperones in maintaining homeostasis of protein folding and are thought to be responsible for the acquisition of thermo tolerance[3]. It is believed that the accumulations of HSPs play a pivotal role in abiotic stress.
Labs working on this gene
- Hunan Provincial Key Laboratory for Germplasm Innovation and Utilization of Crop, Hunan Agricultural University, Changsha 410128, China
- College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128, China
- Crop Gene Engineering Key Laboratory of Hunan Province, Hunan Agricultural University, Changsha 410128, China
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 Zou J, Liu C, Liu A, et al. Overexpression of< i> OsHsp17. 0</i> and< i> OsHsp23. 7</i> enhances drought and salt tolerance in rice[J]. Journal of plant physiology, 2012, 169(6): 628-635.
- ↑ 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Zou J, Liu A, Chen X, et al. Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment[J]. Journal of plant physiology, 2009, 166(8): 851-861.
- ↑ 3.0 3.1 Vierling E. The roles of heat shock proteins in plants[J]. Annual review of plant biology, 1991, 42(1): 579-620.
- ↑ Trent J D. A review of acquired thermotolerance, heat‐shock proteins, and molecular chaperones in archaea[J]. FEMS microbiology reviews, 1996, 18(2‐3): 249-258.
Structured Information
| Gene Name |
Os01g0136200 |
|---|---|
| Description |
16.9 kDa class I heat shock protein |
| Version |
NM_001048490.1 GI:115434393 GeneID:4325698 |
| Length |
752 bp |
| Definition |
Oryza sativa Japonica Group Os01g0136200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:1950930..1951681 |
| Sequence Coding Region |
1951047..1951499 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:1950930..1951681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:1950930..1951681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgctggtgaggcgcagcaacgtgttcgaccccttctccctcgacctctgggaccccttcgacagcgtgttccgctccgtcgtcccggccacctccgacaacgacaccgccgccttcgccaacgcccgcatcgactggaaggagacgccggagtcgcacgtcttcaaggccgacctccccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgtgctggtgatcagcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccgcgtggagcgcagcagcgggcagttcatgcggcggttccggctgccggagaacgccaaggtggaccaggtgaaggccggcatggagaacggcgtgctcaccgtcaccgtgcccaaggccgaggtcaagaagcccgaggtgaaggccattgagatctctggctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSLVRRSNVFDPFSLDLWDPFDSVFRSVVPATSDNDTAAFANAR IDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSS GQFMRRFRLPENAKVDQVKAGMENGVLTVTVPKAEVKKPEVKAIEISG</aaseq> |
| Gene Sequence |
<dnaseqindica>118..570#attcaaggcagagctagtagtggtcacatcgccaattcacagtcgaatcaagcaaaccatccaaatcacacccaactcttcttcttcccatcctccagagatccaagcagcttagccatgtcgctggtgaggcgcagcaacgtgttcgaccccttctccctcgacctctgggaccccttcgacagcgtgttccgctccgtcgtcccggccacctccgacaacgacaccgccgccttcgccaacgcccgcatcgactggaaggagacgccggagtcgcacgtcttcaaggccgacctccccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgtgctggtgatcagcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccgcgtggagcgcagcagcgggcagttcatgcggcggttccggctgccggagaacgccaaggtggaccaggtgaaggccggcatggagaacggcgtgctcaccgtcaccgtgcccaaggccgaggtcaagaagcccgaggtgaaggccattgagatctctggctaaaatggtgaaaacgggagtttgtcaaggtcaaggcgtgtcatgcatgttcactctgaactgtttgcggtgtttcactcgggtttgatggtttttactagtcctatgaactgtgtattcttttgtactctgttgtgagcgcgtttgcacgaagcaataaataaaaataaaatcagcttgtttgt</dnaseqindica> |
| External Link(s) |