Os04g0530500

From RiceWiki
Revision as of 10:55, 29 May 2014 by 潘文波 (talk | contribs)
Jump to: navigation, search
OsRDCP1 was induced by drought stress. Overexpression of OsRDCP1  increased tolerance to drought stress in rice.

Annotated Information

Function

Figure 1. Protein In vitro self-ubiquitination analysis of OsRDCP1.

OsRDCP1 exhinit self-ubiquitination activity in vivo. MBP-OsRDCP1 produced high-molecular-mass smear ladders in a time-dependent manner ( Fig. 1A). In contrast, no ubiquitination was detected when the E1, E2, ATP, or Ub was excluded from the reaction mixture(Fig. 1).

Figure 6. Overexpression of OsRDCP1 increased tolerance to drought stress in transgenic rice plants.

35S:OsRDCP1 transgenic lines exhibited considerably less visual symptoms of drought stress. After 15 days of drought stress, these transgenic lines appeared healthy and showed reduced desiccation damage relative to the wild-type and osrtbp1 plants. while no significant phenotypic differences were detected between the wild-type and osrtbp1 plants.

Homologues

Figure 2. Protein Identification of five homologous rice RING E3 OsRDCP family members.

These five rice OsRDCPs (O. sativa RING domain-containing proteins) paralogs possess a single RING motif in their N-terminal regions and a putative membrane-anchoring domain in their C-terminal regions.The predicted OsRDCP paralogs were 25–79% identical to each other at the amino acid level . among the five paralogs, OsRDCP1 was significantly induced by drought stress in both shoot and root tissues, while the other OsRDCP members were constitutively expressed ( Fig2). The level of the OsRDCP4 transcript was the highest in rice seedlings.

Expression

Figure 3. RNA gel blot analyses of OsRDCP1 mRNA. Light-grown 2- or 4-week- old rice plants .

OsRDCP1 transcript (approximately 1.2 kb) levels were significantly augmented in response to 5–30% water loss ( Fig. 3C). This increase was seen in both shoots and roots with similar degrees of induction. Significant induction of OsRDCP1 transcripts was also detected following cold stress (2, 6, and 24 h at 4 °C) ( Fig. 3D). In contrast, expression of OsRDCP1 was unaffected by high salinity (150 mM NaCl) for at least 24 h.

Evolution

Figure 4. Phylogenetic relationship of RING Ub-ligase homologs from rice, Arabidopsis , hot pepper, and humans .

The coding region of OsRDCP1 is 762 bp and encodes 253 amino acids with a molecular mass of 28.1 kDa and a calculated pI of 7.2. Full-length OsRDCP1 is 37%, 29%, and 31% identical to hot pepper CaRma1H1 [12], Arabidopsis AtRma1, and human RING protein HsRma1, respectively ( Fig. 4). In addition, the RING domain of OsRDCP1 is 48–78% identical to those of hot pepper, Arabidopsis, and human RING proteins.


You can also add sub-section(s) at will.

Labs working on this gene

Woo Taek Kim.Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749, Republic of Korea.

References

1. Hansol Bae;Sung Keun Kim;Seok Keun Cho;Bin Goo Kang;Woo Taek Kim Overexpression of OsRDCP1, a rice RING domain-containing E3 ubiquitin ligase, increased tolerance to drought stress in rice (Oryza sativa L.)

Plant Science, 2011, 180(6): 775-782

Structured Information

Gene Name

Os04g0530500

Description

Zinc finger, RING-type domain containing protein

Version

NM_001059925.1 GI:115459579 GeneID:4336483

Length

3313 bp

Definition

Oryza sativa Japonica Group Os04g0530500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:26931200..26934512

Sequence Coding Region

26931390..26932151

Expression

GEO Profiles:Os04g0530500

Genome Context

<gbrowseImage1> name=NC_008397:26931200..26934512 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:26931200..26934512 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaccagatttacatggctgctgtcaataacaagacttcattgcctgatgatgagccaatgaagaaaattagtggagatatgcctgtgactgctggaaacgcttgctttgactgcaacatttgccttgattttgcagcagagccggtggttactctttgtggtcatctctactgctggccttgcatctatgagtggctatgtccaggggttggatcgactgccagtaacaacagcagtttggcaaggcgacagtgccctgtgtgtaaggctacactctccccagacatgctggtgccattgtatggtcgtggggggagtctgaagaaatcactgaatggtgtgcccattccacgacgaccaaccgtgcagcgggaggcggttgagcatcaaaacacacacaataacatcgatgatcggcaccatgagaacatggaacccagccctccaccacaaccgctgcggcattcgagccatcattccagtgcaactgaatttgattttatttacccgccatcaccaattgggcgtggcttgatccactcgacggctggtggtgtgcttggggggatggcagtggcggtgctaccatgggcattccgtggccaggtgccaccgagcatgttcatgagtccccactatgtcacggcacacaatatgagctctagagcgaggagacatcagatggaagttgagaggtcactgcatcagatctggttcttcctcttcgtttttgtggtgctgtgcctgctcttgttctga</cdnaseq>

Protein Sequence

<aaseq>MDQIYMAAVNNKTSLPDDEPMKKISGDMPVTAGNACFDCNICLD FAAEPVVTLCGHLYCWPCIYEWLCPGVGSTASNNSSLARRQCPVCKATLSPDMLVPLY GRGGSLKKSLNGVPIPRRPTVQREAVEHQNTHNNIDDRHHENMEPSPPPQPLRHSSHH SSATEFDFIYPPSPIGRGLIHSTAGGVLGGMAVAVLPWAFRGQVPPSMFMSPHYVTAH NMSSRARRHQMEVERSLHQIWFFLFVFVVLCLLLF</aaseq>

Gene Sequence

<dnaseqindica>2362..3123#cccgtctcgcctcctccgcaagtgacgtcgacgcctcatctcccctccctctttttccccgcagcgatacggcattcgtgacctcccgattgttgccaacccccctcgccttccgattgctgccacccccgcgcctcgccgcttgcccgtctcctgttcgtccctcgggagcgggaggctagggccgacagcagcgttcgcgccggcgcgggattgggttctttgttcttgtcaggtcagcgggatgaaatctcttgtttccttttgatgtttttttttgtttttgcccgaaagattttgcgttgtctggtcgattggaggaccggtgtgtgtcatgggggttgatctcggttggattcttaggttgctgcctgcccttgggttagctccgaaaggttctgatgctttgctgctgctgctcctcctggcttgtgctgttcgtgcttggggttgtgatgcctttgtccttctcgaggaacaagggaagatcgttgttagctctgtcggtggtctcctttcctttcctcggtttggccaattgtgtgttgatgcgcctgccgcactaggaaatcgacggtgctaaaatcgtttttctacccaatgtccaaccgagaaattgtttatgtttagatttagtgcagtatcaatttgaaccgcactagggaatcgacggtgctaaaatcgtttttttacccaatatccaacttccaaacttctaatttcgtttgtgtattgacgaatgcgtgccctgtgttagacatgagcagacagcatttggaggatttactaccatacacaaatctgaacaattttaacaaaatgtgttcgcactccaaaacatgatttatgatgtaatacactgtttctccacaacattgacttcttgtgtgaattcttaatggtgatagcggtggatttgttgtgtgaattcttaatggtgatagcggttgatgctgctgagcttagcagatccgtgtgcttgattattgtttcgtttcgtagtctcacattcaggatcagttattttgtttcttaaggctactcttattagccgtctatctaaattttaacactaggaatattgatgtgctcccacatttatctaaaatactcaatgtaacaaaacaacgtgtctgaatttgcgatagcctgagcttaagctcaccagttaataatattacacatgggatgagagcaatcaagaaatttcgaagatgctggtggacaaataattcagtgttccctgattctaatacagtatattgccattatctcttggttataattattttagtcggtcactagatatgtgaagtagtggtcttttcggtgtatttgatttaattcaatatgccaaatgatgtagctaatccatcattgttgtgtccacatcactttccacaccttgttttttttttcaataattcacttgtcgatggaccttatcaaccacataaagttcactatgtcatggaagcatttattggagattgggatgggatgcctctcaggcttagtcaactctgctggtttattcgtccatagctgcttacctgaatatttctatagaatcaattagaagagaggcagtattaatctagtcaggacctgccaggctgccatccttgtctaagccgccgtttgtaaactgtgggtgcatattaaatgctaactgttttgtactatgccttttcttcccaaggcatagtaactttaagttggcaatgatggttaatcttaatagtattgactttgcacacataggacataagctgtttcatttccttgctgacaaaagttccccatttatcctgatagataatacttgtagcgtagggataagaatgtcatttgtgataaaaaataaagggcagtgtatctagttcctattgaaaaaattggataatccattccatgactgctgactcagcctgctaggaaagatgatggattcttccttgatgtatcaattgattactaaccaggataatattaagtagtttttttctggcatatagacacggagttttggagctttacctaacatctgcaccactcttcagacttgttaaatgtatttggatagacttcgctggacaggatgatgtggtgtgggccaaaaagctgcattttacctggacccgcttagtttcatataaatctgttggtaccatgtggcttgcgttgttccttccattctcatttctggtgtgttttaagtttttatttctgtacaatgattagtaaagtgggccccactcagtgatgctttacttaactacatgtcatatgcattcctagtgacatatttttgtttgttgaactgcagtgctgtgtttgctcgcaagggtcatcgtgagaatggaccagatttacatggctgctgtcaataacaagacttcattgcctgatgatgagccaatgaagaaaattagtggagatatgcctgtgactgctggaaacgcttgctttgactgcaacatttgccttgattttgcagcagagccggtggttactctttgtggtcatctctactgctggccttgcatctatgagtggctatgtccaggggttggatcgactgccagtaacaacagcagtttggcaaggcgacagtgccctgtgtgtaaggctacactctccccagacatgctggtgccattgtatggtcgtggggggagtctgaagaaatcactgaatggtgtgcccattccacgacgaccaaccgtgcagcgggaggcggttgagcatcaaaacacacacaataacatcgatgatcggcaccatgagaacatggaacccagccctccaccacaaccgctgcggcattcgagccatcattccagtgcaactgaatttgattttatttacccgccatcaccaattgggcgtggcttgatccactcgacggctggtggtgtgcttggggggatggcagtggcggtgctaccatgggcattccgtggccaggtgccaccgagcatgttcatgagtccccactatgtcacggcacacaatatgagctctagagcgaggagacatcagatggaagttgagaggtcactgcatcagatctggttcttcctcttcgtttttgtggtgctgtgcctgctcttgttctgaagcaagatggtggtgtattccttttgtaaatacgggaaggcaagacactaatgggtggatgcatatggtaaaagagggtggttaacactgttggtctgtatcgataagcatgtgcctaaagcatgctgatatagagatgtaatgtgacaagacttaaggtgaaatgcacatttcattcttctcttgtcct</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0530500, RefSeq:Os04g0530500