Os07g0258400

From RiceWiki
Revision as of 04:38, 29 May 2014 by Cui ya (talk | contribs)
Jump to: navigation, search

The rice OsNRAMP1 gene is well known as the "iron transporter gene" and plays a role in Cd & Fe uptake and accumulation in rice.

Annotated Information

Function

Schematic view of transverse section of the transgenic root. (from reference [1]).

OsNRAMP1 gene localized to the plasma membrane and transported Cd as well as Fe. It plays a role in Fe uptake and/or translocation from roots to the aerial parts, including rice grains. OsNRAMP1 may also participate in Cd uptake and/or transport throughout the rice plant [2]. Expression of OsNRAMP1 in yeast mutant (fet3fet4) rescued iron (Fe) uptake and exhibited enhanced accumulation of As and Cd. Expression of OsNRAMP1 in Arabidopsis provided tolerance with enhanced As and Cd accumulation in root and shoot. Cellular localization revealed that OsNRAMP1 resides on plasma membrane of endodermis and pericycle cells and may assist in xylem loading for root to shoot mobilization. This is the first report demonstrating role of NRAMP in xylem mediated loading and enhanced accumulation of As and Cd in plants [1].

GO assignment(s): GO:0016020

Expression

The expression of OsNRAMP1 has been observed mainly in the roots at the vegetative stage [3]. A search of the microarray database RiceXPro16 (http://ricexpro.dna.affrc.go.jp/) revealed that steady-state expression of OsNRAMP1 is observed in the whole plant, i.e., the leaf blade, root, stem, anther, ovary, embryo, endosperm and pistil. In the leaf blade and stem, OsNRAMP1 expression is higher during the reproductive stage [2]. Expression studies in normal plant tissues indicate that while OsNramp1 is expressed primarily in roots, and OsNramp2 is primarily expressed in leaves, OsNramp3 is expressed in both tissues[4].

Evolution

OsNramp1, OsNramp2, and OsNramp3 encode a novel group of highly similar hydrophobic polypeptides sharing between 64% and 75% sequence similarity, that show similar hydropathy profiles, and predicted secondary structure, including the same number, position, and sequence characteristics (including conserved charges) of transmembrane domains. Together, these define a highly conserved membrane associated hydrophobic core. The three plant proteins show a remarkable degree of sequence similarity with their mammalian counterpart (60% to 70% similarity), including primary and secondary structure elements previously described in ion transporters and channels. The recent discovery that the yeast Nramp homologue SMF1 functions as a manganese transporter raises the exciting possibility that OsNramp encodes a family of metal ion transporters in plants[4]. The amino acid sequence of OsNRAMP1 in the Sasanishiki and Habataki cultivars was found to be 100% identical[3].

Knowledge Extension

The NRAMP (natural resistance-associated macrophage proteins) family of metal transporters has been identified in several plant species, and many of the NRAMP family proteins function as Fe transporters[2]. In Arabidopsis, AtNRAMP1, AtNRAMP3 and AtNRAMP4 have been reported to be Fe transporters and also mediate Cd transport. Rice possesses seven putative NRAMP genes. Microarray analysis revealed that only one of these, OsNRAMP1, together with OsIRT1 and OsIRT2, is highly upregulated by Fe deficiency(Table1, the induction ratio was calculated as the increased or decreased expression level after Fe deficiency for 1 week compared with expression under normal conditions (-Fe/+Fe).) [2].

Accession number Gene name Roots Shoots
Os07g0258400 OsNRAMP1 15.1 290.2
Os03g0208500 OsNRAMP2 1.3 0.9
Os06g0676000 OsNRAMP3 1.0 1.1
Os02g0131800 OsNRAMP4 0.6 0.7
Os07g0257200 OsNRAMP5 1.9 0.8
Os01g0503400 OsNRAMP6 1.1 1.0
Os12g0581600 OsNRAMP7 0.7 1.1

Labs working on this gene

  • Graduate School of Agricultural and Life Sciences; University of Tokyo; Tokyo, Japan
  • Research Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan
  • National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-8604, Japan
  • Department of Biochemistry, McGill University, Montreal Quebec, Canada
  • CSIR-National Botanical Research Institute (CSIR-NBRI), Rana Pratap Marg, Lucknow 226001, India
  • Department of Botany, University of Lucknow, Lucknow 226007, India

References

  1. 1.0 1.1 Abdelmajid B, Tony K and Philippe G. (2014) Expression in Arabidopsis and cellular localization reveal involvement of rice NRAMP, OsNRAMP1, in arsenic transport and toleranc. Plant, Cell and Environment 37: 140-152
  2. 2.0 2.1 2.2 2.3 Takahashi R, Ishimaru Y, Nakanishi H, et al. (2011) Role of the iron transporter OsNRAMP1 in cadmium uptake and accumulation in rice. Plant Signal Behav 6:1813-1816.
  3. 3.0 3.1 Takahashi R, Ishimaru Y, Senoura T, et al. (2011) The OsNRAMP1 iron transporter is involved in Cd accumulation in rice. J Exp Bot 62:4843-4850.
  4. 4.0 4.1 Abdelmajid B, Tony K and Philippe G. (1997) Cloning and characterization of the OsNramp family from Oryza sativa, a new family of membrane proteins possibly implicated in the transport of metal ions. Plant Molecular Biology 33: 1085-1092.

Structured Information

Gene Name

Os07g0258400

Description

OsNramp1 (Integral membrane protein)

Version

NM_001065850.1 GI:115471432 GeneID:4342862

Length

4772 bp

Definition

Oryza sativa Japonica Group Os07g0258400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:8998211..9002982

Sequence Coding Region

8998266..8998349,8999394..8999472,8999542..8999582,8999714..8999792,8999874..8999978
,9000219..9000328,9000510..9000691,9000909..9000978,9001066..9001239
,9001373..9001477,9001684..9001815,9002062..9002157,9002273..9002572

Expression

GEO Profiles:Os07g0258400

Genome Context

<gbrowseImage1> name=NC_008400:8998211..9002982 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:8998211..9002982 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggtgacgaaggcggaggcggttgccggcgacggcgggaaggtggtggacgacatcgaggcgctcgccgatctcagaaaggagccagcatggaaaaggtttttgtcccacattggaccaggctttatggtctgtttggcttacctcgatcctggaaatatggagactgatctacaagctggtgccaatcacaaatatgagcttctttgggtgattttgattggcctgatctttgcactgattatacaatcattatcggctaatcttggagtggtgacagggcgccatcttgctgagctgtgcaagactgaatatccagtatgggtgaaaacctgcttatggctgctagcagaactagctgtgattgcttccgatattccagaagttataggtacaggatttgctttcaaccttttgttccacataccagtgtggaccggggttctcattgctggctctagcacgcttcttcttcttggactgcaaagatatggggtaaggaaactggaggttgtggtcgcgctattggtgtttgtcatggcagggtgcttcttcgtggagatgagcatagtcaagcctccggttaatgaggtccttcaaggattattcatccccaggctcagtgggcccggtgccacaggagactccattgcccttcttggggctcttgtaatgccgcacaatctattcttgcactctgccctggtgctgtcgaggaatacacccgcatcagcaaaaggaatgaaggatgtctgtaggttcttcctctttgagagtgggatagctcttttcgtggctctgcttgtcaacattgcaatcatctctgtctccggcactgtatgtaatgcaaccaacctttcaccagaagatgctgtaaaatgcagcgaccttacattggactcctcatccttcctcctcaggaatgtgctaggaaagtcaagtgcgacagtgtacggtgtagcactcttggcttctggacagagctcgaccattactggcacttatgctgggcaatatgttatgcaggggttcctagacatcaaaatgaaacagtggcttcggaacctgatgacacgcagcattgccattgtgcctagcttaatcgtctccatcattggagggtctagtggcgccggtcgtctcatcgtcattgcatcgatgattctatcctttgagctaccatttgctctgatccctcttctcaagttcagcagcagcagcaacaagatgggtgaaaacaagaactccatctatattgttggattctcctgggtgctggggttcgtcatcatcgggataaacatctacttcctcagcacaaagctggtcggctggatcctccacaacgcgctcccgacattcgccaacgtgctcatcggcatcgtgctgttcccgctcatgctgctctacgtcgtcgccgtgatctacctgacgttcaggaaggacaccgtcaagttcgtgtctcgtcgtgagctgcaggccggcgacgacaccgagaaagcacaggtagccacctgcgtcgccgacgagcacagcaaagagccacccgtgtag</cdnaseq>

Protein Sequence

<aaseq>MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFM VCLAYLDPGNMETDLQAGANHKYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELC KTEYPVWVKTCLWLLAELAVIASDIPEVIGTGFAFNLLFHIPVWTGVLIAGSSTLLLL GLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSI ALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRFFLFESGIALFVALLVNIAIIS VSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSSATVYGVALLASGQSSTITG TYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGGSSGAGRLIVIASMILSF ELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGINIYFLSTKLVGWILHN ALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDTVKFVSRRELQAGDDTEKAQVATCV ADEHSKEPPV</aaseq>

Gene Sequence

<dnaseqindica>56..139#1184..1262#1332..1372#1504..1582#1664..1768#2009..2118#2300..2481#2699..2768#2856..3029#3163..3267#3474..3605#3852..3947#4063..4362#agttgttgagaggcaaggcaaactcaggcgactgagctaaagaagccgcactagtatgggggtgacgaaggcggaggcggttgccggcgacggcgggaaggtggtggacgacatcgaggcgctcgccgatctcagaaaggttaattctctctgcaaatactcctggttgctcatacttaaatctacctatgaatgagggatcgcatcgatgtcgcagttggagttggacggacaggagtgagaaattattatctctgatctgattcctgttggtatgcactcttgctgtttgtgaaaatgccccagaggatgcatccacaggacacggcgccttcaatatttataagttgattcaatgatgggtttctttcatgtttctttgctgaaaaatcgtgtttagtagagtagtcttctatgtctctattcaaaagaaaagtggcattaagttataggagaaaataaaagggagaagtcgttttgttaattaggagcttctcctttcgataactatgacttaatagttcatttttattatggaacaaagatgagatacaaaacaatagattgtgatcacctcagtttttttgtttgatatcaagtctgacaaactaaggcattacggttctctgctcttgtttgacaaacgaagtctattgtacaatagaagtctgttgtttaatgtctctacttttggtcatctcttgtatggtttagcctagatctcagtttatcttactataggtcgccgatagtacaatatgatttgtttctccgccgtacctaatccaaaatcatatagcttgacattatctgcttcgcatagatgttcgttataagcttcaaattacaaatttcatattgaaagtttagcctcttcttgttggactataatagcgagtccatgtgaacatcatttcttacattaatatacatttcttcacatttgtggctagttattttacttgccctaccattgtcgcatttatttatatttccataactcattttccaatgcttagttgaatgtatcattcactcattcttgtattgtttgtacgtctttgagactttgactgaaaatagtcttagttttgtacctattttatattttgctttatgttttaattattttctttgacatgatgtgcatgcatatttattactaattggtcatgtaacacaggagccagcatggaaaaggtttttgtcccacattggaccaggctttatggtctgtttggcttacctcgatcctggaaatagtaatattctctctctaaatttattttctcacactcatatggtttctcacgcttgacgaattgaaacagtggagactgatctacaagctggtgccaatcacaaatatgaggtacattctctagccttttctatatgacttttcctgccatttatcacagttgtcatgtcttttgttacagcgagaagaaagaaacaattaactgatatgcttcttgatgtgctctttcatatgtttcttagcttctttgggtgattttgattggcctgatctttgcactgattatacaatcattatcggctaatcttggagtggtgacaggtaataaatagacactttcagcacacaattgatttaacatttcagttggaagtagcaagtaatgaatgtcaattgatacagggcgccatcttgctgagctgtgcaagactgaatatccagtatgggtgaaaacctgcttatggctgctagcagaactagctgtgattgcttccgatattccagaaggttggaaatagaatgatagatctaaataaaaaaaagttaatgtttaactgtcacctttgagtttcagttgattaagtttataaactctctcactgatataagtgtacgagcaacacttgcactgattgtatacagtctcttatccactaaacattatgatatgtagcactttttctgagaagaaagcaacaacatctaatctaatatttggtgttttttacacatgtaccttttgtgcagttataggtacaggatttgctttcaaccttttgttccacataccagtgtggaccggggttctcattgctggctctagcacgcttcttcttcttggactgcaaagatatggggtaaccaactatttatgactggatatatgatagatgtctgtataaaatgttttaatgaatgtctaaacatcattgtattgtatttgatcattactgtttggtcattgtaaatggtggtcattacaaatgggtttgttgttgaattgacttgtttgcatttttccttcatctatataactaggtaaggaaactggaggttgtggtcgcgctattggtgtttgtcatggcagggtgcttcttcgtggagatgagcatagtcaagcctccggttaatgaggtccttcaaggattattcatccccaggctcagtgggcccggtgccacaggagactccattgcccttcttggggctcttgtaatgccgtaagcagtcaaacatgcatatatacccccagttgttaatgtgtgcaatgtcttttttgcgtcttaagattcttctagggtagctgtaaacatgcataaggttttcaactctccagtaattacaaatctccacaatggtagttttagtctttttttagattttgacaaaatgcactcttgttaatcataagtgagcattatcagttattaattacaggcacaatctattcttgcactctgccctggtgctgtcgaggaatacacccgcatcagcaaaaggaatgaaggtgatcagatgtccgtgttcttgcattaaaaaagaaatggtactcctagttggctgatacatattccttcattcttttgtactccaggatgtctgtaggttcttcctctttgagagtgggatagctcttttcgtggctctgcttgtcaacattgcaatcatctctgtctccggcactgtatgtaatgcaaccaacctttcaccagaagatgctgtaaaatgcagcgaccttacattggactcctcatccttcctcctcagggtactgcatatatgtgcaaagttcatcaccatttatatttagttgtgttattttcttcacaaaaataaattagtcatgttatcattgaccatataatggtcatttacagaattattatttatttttttttcagaatgtgctaggaaagtcaagtgcgacagtgtacggtgtagcactcttggcttctggacagagctcgaccattactggcacttatgctgggcaatatgttatgcaggtatattttacctgaactctaaccttgtttacaaattaaccaagtactatctgtgaactattttcttaatgaccagttcaagtggtatagtattaaccacgcagtaaactagaagatctccaaaatggtgaaagaaatgaaaaaaagtttgcaatctatcaagcttgaatgtatagtaacagttttttttttccatgtatctacaggggttcctagacatcaaaatgaaacagtggcttcggaacctgatgacacgcagcattgccattgtgcctagcttaatcgtctccatcattggagggtctagtggcgccggtcgtctcatcgtcattgcatcggtacaatcttttactacaaatgaaaatatcagtttgcccataagaacactcattaaaaaaaactgccatacaatcaaccatcttctaattttctcaataattagtaagttatttgctaatcgaaatgcttctttcttcaaaaaatggacggtatgtaatttgttgtacctcattccttctgatcatactgttaaaaagaatcaaaacctaatgcttgttttggtttggctgttacgtttcatacagatgattctatcctttgagctaccatttgctctgatccctcttctcaagttcagcagcagcagcaacaagatgggtgaaaacaagaactccatctatgtaagcactcccccatcaatcaatcaatccttctttctagcttgtccacacatagaaaacaaaaacaaaaaaaatcctggaaaactaataatgcattggtaattaaaacctgcagattgttggattctcctgggtgctggggttcgtcatcatcgggataaacatctacttcctcagcacaaagctggtcggctggatcctccacaacgcgctcccgacattcgccaacgtgctcatcggcatcgtgctgttcccgctcatgctgctctacgtcgtcgccgtgatctacctgacgttcaggaaggacaccgtcaagttcgtgtctcgtcgtgagctgcaggccggcgacgacaccgagaaagcacaggtagccacctgcgtcgccgacgagcacagcaaagagccacccgtgtagtacccttccagaccggttaccggtgttggctggtttttattggatagatgtttaggtccaattttttttatataaaaaatccaatagatgtttaggtccaaatttttgaattcaaaaaccggttagcagtgataaccggctgaaattttggcccatgggagtagattgttgctttttttcttagtgattagttattggcagattggcagaatgttgtagctaggcaatctaattgtatggttagatatttagtcataaatccaagagtgagttttcttggatgcgaggacaaggacaatctaattgtatggttagatatttagtcataaatccaagagtgagttttcttggatgcgaggacaaggacaaatataaatgtaaataaatgcagttaaagtaacaccttgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0258400, RefSeq:Os07g0258400