Os08g0174500
The rice Os08g0174500 is a major QTL located at chromosome 8 of rice with pleiotropic effects on grain yield, heading date, and plant height[1][2][3]. It was reported as DTH8, Ghd8 and LHD1 in 2010, 2011 and 2012, espectively[1][2][3].
Contents
Annotated Information
Function
- Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). OsDTH8 is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as Ehd1, Hd3a and RFT1[1][2][3].
- OsDTH8 can also influence plant height and yield potential by the regulation of stem growth and panicle development [1][2][3]. It was considerd that OsDTH8 could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential[2].
GO assignment(s): GO:0003677, GO:0005622, GO:0005634, GO:0043565
Wild Type & Mutants
- The population genetics analysis made by Xiangjin Wei et al. in 2010 showed that the chromosome segment substitution lines of OsDTH8 under the Asominori genetic background (Japonica) diplayed earlier heading than Asominori. Their plant height, number of grains per panicle, yield, and dry weight per plant decreased significantly in compared with Asominori NLD condition (Figure 1)[1].
- The transgenetic analysis in rice made by Wen-Hao Yan et al. showed that the positive T1 plants of OsDTH8 could produce more grains. They displayed significantly delayed heading with taller culms compared to the transgenic negative plants. On the whole, a positive T1 plant resulted in an increases 60% in grain yield per plant and grains per panicle compared to the control group[2].
- The transgenetic analysis in Arabidopsis by Wen-Hao Yan et al. showed that transformants of OsDTH8 can bloom about 10 days earlier than the wild-type under LD conditions, however, no obvious difference was observed between the transformants and wild-type under SD conditions (Figure 2)[2].
Expression
- The expression pattern analysis made by Xiangjin Wei et al. showed that OsDTH8 was expressed in leaves, leaf sheaths, culms, young panicles and roots. However, its expression levels were higher in roots, young panicles, and leaves than those in leaf sheaths and culms (Figure 3)[1].
- OsDTH8 could negatively influence the expression of Ehd1, Hd3a and RFT1 but not Hd1 and Ghd7[1][2][3].
Subcellular Localization
- The subcellular localization analysis made by Xiangjin Wei et al. suggests that OsDTH8 is a nuclear protein[1].
Gene Structure
Labs working on this gene
- State Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Provincial Center of Plant Gene Engineering, Nanjing Agricultural University, Nanjing 210095, China;
- Chinese National Center for Rice Improvement, China National Rice Research Institute, Hangzhou 310006, China;
- Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 100081, China;
- National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan;
- State Key Laboratory of Plant Physiology and Biochemistry, National Evaluation Centre for Agricultural Wild Plants (Rice), Laboratory of Crop Heterosis and Utilization of the Ministry of Education, Beijing 100193, China;
- Beijing Key Laboratory of Crop Genetic Improvement, Department of Plant Genetics and Breeding, China Agricultural University, Beijing 100193, China.
References
Please input cited references here.
Structured Information
| Gene Name |
Os08g0174500 |
|---|---|
| Description |
Similar to HAP3 |
| Version |
NM_001067642.1 GI:115475020 GeneID:4344784 |
| Length |
1640 bp |
| Definition |
Oryza sativa Japonica Group Os08g0174500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:4332728..4334367 |
| Sequence Coding Region |
4332849..4333742 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattag</cdnaseq> |
| Protein Sequence |
<aaseq>MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYV VYGGGGGGDSPAKEQDRFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVT GEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAG GAAAARHGEGGCCGGGGGGADGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGG DAGVGYNAGAGSTTTAFYAPAATAASGNKAYCGGDGSRVMEFEGIGGEEESGGGGGGG ERGFAGHLHGVQWFRLKRNTN</aaseq> |
| Gene Sequence |
<dnaseqindica>626..1519#tcggtcattagtatatgttagtataaattaaataattaaacaccttaaacaatattttttcgtcgtagtttgatcatcacctaagattttttagtcttttcaaaatgatcatcagctaacaagtgtatctttatttatttgtgcaagaagtaaatgagcatcattgaatgcgctgcacacatgtaatgcaaacaaccaagttaatttttattggtgcaacggcgcgcactatttaaaacgtgacgcaatgcagcgatagagcaccttgatagataagaattaatttcagcatgatgtagattttgttatccttaatctctactcactttgcataggtaataaattaaaccgctgaactattactacatggtttacatgaaaggtgatcgggtagggacgagaatgtcgcgacacacataatatatatagtagcgtccttatgtttgctttgtgtccgcatcgataccgtcttcccactcgcatctcctcacctcctttccttctttaaaaggagagcatcaccactccatcctcaactcccataacctcccccttctctctctctctaactacacactctctctctagctagctagctagctatagctagtgttgttagcttcacatgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattagctagctaggcacacgcgtagttttattattacttaattaccgcgttaattaattgttgatgctgatgctgtttaaaattgattctccttttgcatgaaatgtttgatggtatggtttaaaa</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ 3.0 3.1 3.2 3.3 3.4 Cite error: Invalid
<ref>tag; no text was provided for refs namedref3