Os01g0907900
Please input one-sentence summary here.
Contents
Annotated Information
Function
Taken together, our results indicated that the patatin-like PLA2 might play a significant role in the formation of vascular bundles, and that the dep3 mutant may provide another EP resource for rice breeding programsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Leafy head2, which encodes a putative RNA-binding protein, regulates shoot development of riceCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Mutants with abnormal leaf developmental patterns not only provide a great insight into understanding the regulatory mechanism of plant architecture, but also enrich the ways to its modification by which crop yield could be improvedCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
We show that PLA2 normally acts to retard the rate of leaf maturation but does so independently of PLA1, which encodes a member of the P450 familyCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
It was unusually stable with regard to heat, acidity, and organic solvents but was sensitive to disulfide bond-reducing agentsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Phospholipase A(2)s (PLA(2)s) constitute a large superfamily of enzymes whose products are important for a multitude of signal transduction processes, lipid mediator release, lipid metabolism, development, plant stress responses, and host defenseCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Instead, it produced a leafy panicle, in which all primary rachis-branches were converted to vegetative shootsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Architecture of the rice inflorescence, which is determined mainly by the morphology, number and length of primary and secondary inflorescence branches, is an important agronomical traitCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
These results indicate that both PLA1 and PLA2 act downstream of the GA signal transduction pathway to regulate leaf developmentCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Comparison of genome-scale expression profiles between wild-type and lhd2 plants suggested that LHD2 may regulate rice shoot development through KNOX and hormone-related genesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Although the pattern of leaf initiation is a key element of plant shoot architecture, little is known about how the time interval between initiation events, termed plastochron, is regulatedCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.)Cite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Here, we present a detailed analysis of plastochron2 (pla2), a rice (Oryza sativa) mutant that exhibits shortened plastochron and precocious maturation of leaves during the vegetative phase and ectopic shoot formation during the reproductive phaseCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
During vegetative development, higher plants continuously form new leaves in regular spatial and temporal patternsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
In a Dissociation (Ds) insertion rice population, we identified a mutant, compact shoot and leafy head 1 (csl1), which produced massive number of leaves (~70) during the vegetative phaseCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
PLA3/GO encodes a glutamate carboxypeptidase, which is thought to catabolize small acidic peptides and produce small signaling moleculesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
CSL1 may represent a novel gene, which functions downstream of PLA1 and/or PLA2, or alternatively functions in a separate pathway, involved in the regulation of leaf initiation and developmental transition via plant hormones or other mobile signalsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Double mutant analysis revealed that PLA1, PLA2 and PLA3 are regulated independently but function redundantlyCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Despite the importance of PLA genes in plant development, their molecular functions remain unknownCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The mutant allele gene carried a 408 bp genomic deletion within LOC_Os06g46350, which included the last 47 bp coding region of the third exon and the first 361 bp of the 3'-untranslated regionCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Based on these analyses, we propose a model in which plastochron is determined by signals from immature leaves that act non-cell-autonomously in the shoot apical meristem to inhibit the initiation of new leavesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
preceded by a 25 amino acid signal peptide), and were derived from four expressed sequence tag (EST) clonesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Here we report the identification of the rice gene PLASTOCHRON3 (PLA3)/GOLIATH (GO) that regulates various developmental processes including the rate of leaf initiation (the plastochron)Cite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
csl1 is most likely a dominant mutation because no mutant segregant was observed in progeny of 67 siblings of the csl1 mutantCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The crystal structure of rice (Oryza sativa) isoform 2 phospholipase A(2) has been determined to 2.0 A resolution using sulfur SAD phasing, and shows that the class XIb phospholipases have a unique structure compared with other secreted PLA(2)sCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The C-terminal half is folded into three anti-parallel alpha-helices, of which the two first are also present in other secreted PLA(2)s and contain the conserved catalytic histidine and calcium liganding aspartate residuesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
A 53-amino acid-long N-terminal sequence was determined and aligned with other sequences, giving 62% identity to the deduced amino acid sequence of some rice (Oryza sativa) expressed sequence tag clonesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
We found that gibberellin (GA) is the major phytohormone that promotes PLA1 and PLA2 expressionCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The full sequences of two distinct but homologous rice (Oryza sativa) cDNAs are given hereCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
This sequence was different from but homologous to the PLA2-I and PLA2-II sequencesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Phenotypically csl1 resembled pla mutants in short plastochron but was more severe in the conversion of the reproductive organs to vegetative organsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The N-terminal half of the chain contains mainly loop structure, including the conserved Ca(2+)-binding loop, but starts with a short 3(10)-helix and also includes two short anti-parallel beta-strandsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in riceCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Recently, we purified to homogeneity and characterized a low-molecular-weight calcium-dependent phospholipase A2 (PLA2) from developing elm seed endospermCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
However, in contrast to pla1 and pla2, pla3 showed pleiotropic phenotypes including enlarged embryo, seed vivipary, defects in SAM maintenance and aberrant leaf morphologyCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Purification and characterization of a low-molecular-weight phospholipase A2 from developing seeds of elmCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Phospholipase A2 (PLA2) was purified about 180,000 times compared with the starting soluble-protein extract from developing elm (Ulmus glabra) seedsCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
They contained twelve conserved cysteine residues and sequences that are likely to represent the Ca(2+)-binding loop and active-site motif, which are characteristic of animal secretory PLA2sCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The octanoate molecule in the complex structure is bound in a hydrophobic pocket, which extends to the likely membrane interface and is proposed to model the binding of the product fatty acidCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
On sodium dodecyl sulfate-polyacrylamide gel electrophoresis the purified fraction showed a single protein band with a mobility that corresponded to 15 kD, from which activity could be recoveredCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Southern blot analysis suggested that multiple copies of such genes are likely to occur in the rice and in other plant genomesCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathwayCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Rice PLASTOCHRON 1 (PLA1) and PLA2 genes regulate leaf maturation and plastochron, and their loss-of-function mutants exhibit small organs and rapid leaf emergenceCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The dep3 mutation also regulated other panicle characteristics, including panicle length, grain shape and grain number per panicleCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
PLASTOCHRON2 regulates leaf initiation and maturation in riceCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The shoot apical meristem (SAM) produces lateral organs in a regular spacing (phyllotaxy) and at a regular interval (phyllochron) during the vegetative phaseCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
These encode mature proteins of 1 19 amino acids (PLA2-I, preceded by a 19 amino acid signal peptide) and 128 amino acids (PLA2-IICite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
They encode a cytochrome P450 protein CYP78A11 and an RNA-binding protein, respectivelyCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The DEP3 gene was identified as the candidate via a map-based cloning approach and was predicted to encode a patatin-like phospholipase A2 (PLA2) superfamily domain-containing proteinCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The molecular and genetic analysis showed that LHD2 encodes a putative RNA binding protein with 67% similarity to maize TE1Cite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
The corresponding PLA2 gene is revealed to be an orthologue of terminal ear1, a maize (Zea mays) gene that encodes a MEI2-like RNA binding proteinCite error: Invalid <ref> tag;
name cannot be a simple integer. Use a descriptive title.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Structured Information
| Gene Name |
Os01g0907900 |
|---|---|
| Description |
Similar to Terminal ear1 |
| Version |
NM_001051674.1 GI:115441718 GeneID:4324983 |
| Length |
3557 bp |
| Definition |
Oryza sativa Japonica Group Os01g0907900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:41279485..41283041 |
| Sequence Coding Region |
41279485..41280220,41280332..41280500,41280573..41281076,41281207..41281335,41282437..41282578 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:41279485..41283041 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:41279485..41283041 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggaggaaggaggtgggagtggcgtgggtgggatgcagggagcggcgtcgaatcttctggacgccggagctcaggcgttctaccctgccgtcggcgcgccgttcccgttccagcagcttccgcaccagctgtactgcccgcagccgccgccgccgccgtaccaggtcatgccggtgccgccgccgccgccgccggtgggcttgcctgtaccgccgctgccggcgacgatggcgccgcagccgggctactgcgtgccggcggccgcgacggtggtggacggtccggccagccgcgccgtcgtgctgagcctggtgccgccgcacgcgccggaggacgagatcgcccgcgcgatggctccgttcggtgcggtgcgcgccgtggacgcgtcggcggtggcgtccgagggcgtcgcgaccgtctacttcttcgatctccgctccgccgagcacgccgtcacgggggtccgcgagcagcacatccggcagcagtgccggctcggccagctctacgccgccgccgccgccgccgccgcctcgtccccgacctggcccccgccggcgtgggactggccccacgacgacaaccgcgggctcgtcctcggccaggccgtctgggcccacttcgccgccgcctccaccgtccccgacgacggcgccagccgcggctccctcgtcgtgctcaattccctccccgccatgtccgtgttcgaactccgcgaaatcttccaagcatacggtgacgtgaaggacgtgagggagtcggcgctgcggccgagcaacaagttcgtcgagttcttcgacacgcgcgacgccgaccgcgcgctccacgagctcaacggcaaggagctcttcggccgccgcctcgtcgtcgagtacacgcgcccttccctccccggcccacgcaggcgcgggcacgtgtcgcaccagcccttggccccgacgccgccgaggctgcaggcggcttggcggccggcgccggcgccgtcgcagtctgcgcagccgtcgtcgtctggctccggcaaggcgagggaaggcgtggtgcttctgcgcaggagctccgggaaaggtagctcgggtagccagtccaagggcggtggcaatgctggccacgagcggaagagcaagggcggcaagagcgccgcggcggcgtgttcgacggcggcttcagcatcgtcgtctaccgcaacggcgcccagcaagcaaagccagaaaggcggcggcggcggcggcggccgtggcgggagctggagaggccagaagagcgggtgggaggctcgcttcctgttcaaagaacccgaggccgcggccgccgccgccggcgacgctgccgcctccgagacgcatgagccggcgagctgcaaggacacgagaaccaccgtgatgatcaggaacatcccaaacaagtacagccagaagctgctgctcaacatgctggacaaccactgcatcctctccaaccagcagatcgaggcgagctgcgaagacgaagcccagccattctcctcctacgatttcctctacctccccatagatttcaacaacaagtgcaacgtgggctatggcttcgtcaacctcacctcgccggaggctgccgtgcggctgtacaaggcgttccacaagcaaccgtgggaggtgttcaactcgcgcaagatttgccaagtgacatacgcacgcgtgcaaggcctggacgcgctcaaggagcacttcaagaactccaagttcccgtgcgacagcgacgagtacctgcccgtggtgttctcgccgccgcgggacggcaagctgctcacggagccggtgccgctggtcggccgctcgccggcaccgtcgtcggcgtccggggcgtcgtcgccgcccaagagctgcgccgcgagcgtcgacccactcgcgcaggagctcatgacagcgccgtcttcctccggcgacggcgcctcctccgcctcctcgtccaatgcccacgccgacgaggatgacgtccatggcgaaaccggtggtgaccgtggcgacgacgcggggctcgatctggagctacagcgcctaggctacactgactag</cdnaseq> |
| Protein Sequence |
<aaseq>MEEGGGSGVGGMQGAASNLLDAGAQAFYPAVGAPFPFQQLPHQL YCPQPPPPPYQVMPVPPPPPPVGLPVPPLPATMAPQPGYCVPAAATVVDGPASRAVVL SLVPPHAPEDEIARAMAPFGAVRAVDASAVASEGVATVYFFDLRSAEHAVTGVREQHI RQQCRLGQLYAAAAAAAASSPTWPPPAWDWPHDDNRGLVLGQAVWAHFAAASTVPDDG ASRGSLVVLNSLPAMSVFELREIFQAYGDVKDVRESALRPSNKFVEFFDTRDADRALH ELNGKELFGRRLVVEYTRPSLPGPRRRGHVSHQPLAPTPPRLQAAWRPAPAPSQSAQP SSSGSGKAREGVVLLRRSSGKGSSGSQSKGGGNAGHERKSKGGKSAAAACSTAASASS STATAPSKQSQKGGGGGGGRGGSWRGQKSGWEARFLFKEPEAAAAAAGDAAASETHEP ASCKDTRTTVMIRNIPNKYSQKLLLNMLDNHCILSNQQIEASCEDEAQPFSSYDFLYL PIDFNNKCNVGYGFVNLTSPEAAVRLYKAFHKQPWEVFNSRKICQVTYARVQGLDALK EHFKNSKFPCDSDEYLPVVFSPPRDGKLLTEPVPLVGRSPAPSSASGASSPPKSCAAS VDPLAQELMTAPSSSGDGASSASSSNAHADEDDVHGETGGDRGDDAGLDLELQRLGYT D</aaseq> |
| Gene Sequence |
<dnaseqindica>1..736#848..1016#1089..1592#1723..1851#2953..3094#3186..3557#atggaggaaggaggtgggagtggcgtgggtgggatgcagggagcggcgtcgaatcttctggacgccggagctcaggcgttctaccctgccgtcggcgcgccgttcccgttccagcagcttccgcaccagctgtactgcccgcagccgccgccgccgccgtaccaggtcatgccggtgccgccgccgccgccgccggtgggcttgcctgtaccgccgctgccggcgacgatggcgccgcagccgggctactgcgtgccggcggccgcgacggtggtggacggtccggccagccgcgccgtcgtgctgagcctggtgccgccgcacgcgccggaggacgagatcgcccgcgcgatggctccgttcggtgcggtgcgcgccgtggacgcgtcggcggtggcgtccgagggcgtcgcgaccgtctacttcttcgatctccgctccgccgagcacgccgtcacgggggtccgcgagcagcacatccggcagcagtgccggctcggccagctctacgccgccgccgccgccgccgccgcctcgtccccgacctggcccccgccggcgtgggactggccccacgacgacaaccgcgggctcgtcctcggccaggccgtctgggcccacttcgccgccgcctccaccgtccccgacgacggcgccagccgcggctccctcgtcgtgctcaattccctccccgccatgtccgtgttcgaactccgcgaaatcttccaagcatacggtacatacaccaccaccgcacgctttcttccgcgaattcctccatgtttcgcttcttgtgtttccaaccaattcattctcttggtcgggtcgcctcgtcgtgtgtttgcaggtgacgtgaaggacgtgagggagtcggcgctgcggccgagcaacaagttcgtcgagttcttcgacacgcgcgacgccgaccgcgcgctccacgagctcaacggcaaggagctcttcggccgccgcctcgtcgtcgagtacacgcgcccttccctccccggcccacgcaggtaaaagaattcaccgtcgtgttaattcccatcgaaaacgcacggtaaaactaatttggctgtggttggcaggcgcgggcacgtgtcgcaccagcccttggccccgacgccgccgaggctgcaggcggcttggcggccggcgccggcgccgtcgcagtctgcgcagccgtcgtcgtctggctccggcaaggcgagggaaggcgtggtgcttctgcgcaggagctccgggaaaggtagctcgggtagccagtccaagggcggtggcaatgctggccacgagcggaagagcaagggcggcaagagcgccgcggcggcgtgttcgacggcggcttcagcatcgtcgtctaccgcaacggcgcccagcaagcaaagccagaaaggcggcggcggcggcggcggccgtggcgggagctggagaggccagaagagcgggtgggaggctcgcttcctgttcaaagaacccgaggccgcggccgccgccgccggcgacgctgccgcctccgagacgcatgagccggcgagctgcaaggacacgagaaccaccgtgatgatcaggaacatcccaaacaagtacaggtcactccgctagcttccacgttgttgacgaaatgctatatttcatgggcgccgcgagcccagaattgcctgcctcgcattgcgagcttggcactgatgcctgagcttgtcgtctgttgcttgttcgcagccagaagctgctgctcaacatgctggacaaccactgcatcctctccaaccagcagatcgaggcgagctgcgaagacgaagcccagccattctcctcctacgatttcctctacctccccatagatttcaagtgagtcagctcccgatatgctgtatttatattttatggtgcccaatgcaagaacactgcggcacacactgtccacgcccaatgacaatgacggcctccatgcttcatttccgactgagaattcagtcctagaaaactaattaattttatgattcttgaggggaattgtgcaatggaattgcattgccgtgtgaaggaaggacaaaggtatatgaaaggggcttggaaatgtactgggagatgaatgggtagttgggagctctagctgctggtagtgatgtgtgagcttgtggatcgagttatctttgggctgggtagtactagcatgttactgcactgtactgctagtctgcaacacatatggacgcctactctggtgccatggctgtaatagcccaaatggaaaggaaattggcagtccaagggagatcacaccagatccttctcgttttgatgcatcaaatccttttgttgcatgcaatcctctgatcatgagcatctgttcacatgtctacctttcttgcgcacctgcctctaggatctcctgcctgccttgctctctttcttgcttgcttgcgctgtcttgacctgcacttccatagcaaagtccaacgcaaaaaggaggggctagacgtcatggagtagcggtgaaaaggtgcatcaatgcaaaagcgttttcaattttgacatgtagtaatatatttcttttcctgagaaaaaggtatggtgaccaatgcataattaagcactttcttttcactggagtaccaacttttatctttgcacgaaccaagttgagaaaagacctatcaaatgccccaatgactagcgtgcattgtggaatcaaaaggtagctccacaacaaaaatatgatagaaatattgttgtgcaagtttatagttccccgagcttctgacttcgaaggcctcaattccaagaatatttgtgttcttgaccttgacaagtcgtttgttatcattcataactcatttttggtcacccggttctttatcgcttctctacttgttgagaagtttttaaattcaggcattaaattatcttttcggctgtgctaacctgctaaaatatgaggccatgcagcaacaagtgcaacgtgggctatggcttcgtcaacctcacctcgccggaggctgccgtgcggctgtacaaggcgttccacaagcaaccgtgggaggtgttcaactcgcgcaagatttgccaagtgacatacgcacgcgtgcaagtacgagcgccgttaaatctctcccaattgtgctgataaatctagaccgatcatcatgtgtggcaagtgctaaacccgtgcatgcgcgcagggcctggacgcgctcaaggagcacttcaagaactccaagttcccgtgcgacagcgacgagtacctgcccgtggtgttctcgccgccgcgggacggcaagctgctcacggagccggtgccgctggtcggccgctcgccggcaccgtcgtcggcgtccggggcgtcgtcgccgcccaagagctgcgccgcgagcgtcgacccactcgcgcaggagctcatgacagcgccgtcttcctccggcgacggcgcctcctccgcctcctcgtccaatgcccacgccgacgaggatgacgtccatggcgaaaccggtggtgaccgtggcgacgacgcggggctcgatctggagctacagcgcctaggctacactgactag</dnaseqindica> |
| External Link(s) |