Os01g0831000
Please input one-sentence summary here.
Contents
Annotated Information
Function
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking[1]. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.
Mutation
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.
An insertion of a retro transposon was detected in the lax-1 allele[2].
The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele[2].
A 59-bp region was deleted in lax-3.
Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
Expression
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem[2].
Evolution
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching[2].
Knowledge Extension
Labs working on this gene
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan
2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan
3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan
4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan
References
Structured Information
| Gene Name |
Os01g0831000 |
|---|---|
| Description |
Transcription factor LAX PANICLE |
| Version |
NM_001051234.1 GI:115440838 GeneID:4327431 |
| Length |
1078 bp |
| Definition |
Oryza sativa Japonica Group Os01g0831000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37313995..37315072 |
| Sequence Coding Region |
37314110..37314757 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq> |
| Protein Sequence |
<aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq> |
| Gene Sequence |
<dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica> |
| External Link(s) |