Os06g0594600
Please input one-sentence summary here.
Contents
Annotated Information
Function
The overexpression of the rice gene -- OsAt10(LOC_Os06g39390) -- can effect the hydroxycinnamic acid content and saccharification in the rice cell wall.rice mutants with altered expression of four of these genes have altered cell wall hydroxycinnamate content. In-depth characterization of ectopic expression lines for one gene, OsAt10, revealed that this modification increases matrix polysaccharideassociated ester-linkedp-CA while simultaneously decreasing matrix polysaccharide-associated FA.OsAt10 overexpression plants exhibit increased in vitro saccharification, with no discernible effects on vegetative development. Thus, this gene is a useful target for improving biofuel and feed production.
Expression
For the remaining 11 lines, we characterized the alkali-labile hydroxycinnamoyl ester content of cell wall alcohol-insoluble residue (AIR) from leaf blades and sheaths of side tillers. We compared homozygous, mutant, and wild-type segregant plants 7 or 10 weeks after planting. The screen revealed four mutants with possible cell wall hydroxycinnamic acid phenotypes . All four lines showed changes in the expression of the nearest acyltransferase gene to the T-DNA insertion site via quantitative reverse transcription (qRT)-PCR. Homozygous mutant progeny of4A-03423(here afterreferred to asOsAT10-D1), which has increased expression of OsAt10, exhibited reduced FA (approximately 60% less) and an increase in p-CA (approximately 300% more) in sheaths and leaves.TheT-DNA insertions it efort helinewerefertoas OsAT10-D1(PFG_4A-03423) is approximately 8.5 kb downstream of the transcriptional start site forOsAt10. The insert is oriented with the activating sequences proximate toOsAt10and in the range observed to activate expression (Jeong et al., 2006). As mentioned above, qRT-PCR indicated that, indeed,the expression ofOsAt10was increased by more than 100-fold in the leaves of homozygous OsAT10-D1 plants (Fig. 3B). InOsAT10-D1, besides OsAt10the expression of other genes proximate to the site of the T-DNA insertion does not vary significantly relative to the wild type (Fig. 3B). Similarly, the expression of related OsAtgenesdoesnotvarysignificantly in OsAT10-D1(Supplemental Fig. S2), reducing the possibility that the observed phenotype is due to compensation at the level of gene expression of a related acyltransferase. Of the acyltransferase transcripts examined in this survey, OsAt6appears to vary the most, although not significantly. However, OsAt6(LOC_Os01g08380) is expressed near the lower limitofourdetectionand,infact,wasreportedas undetectable in a previous qRT-PCR study (Piston et al., 2010). OsAT10-D1lines show no change in size and dry mass at maturity (Fig. 4, A and B). However, we did measure an approximately 20% to 30% decrease in total seed mass per plant for the mutant compared with the wild type.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. Bartley, L.E., et al., Overexpression of a BAHD acyltransferase, OsAt10, alters rice cell wall hydroxycinnamic acid content and saccharification. Plant physiology, 2013. 161(4): p. 1615-1633.
Structured Information
| Gene Name |
Os06g0594600 |
|---|---|
| Description |
The start codon is not identified. |
| Version |
NM_001064516.2 GI:297606110 GeneID:4341427 |
| Length |
1126 bp |
| Definition |
Oryza sativa Japonica Group Os06g0594600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24256206..24257331 |
| Sequence Coding Region |
24256486..24257331 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24256206..24257331 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24256206..24257331 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>gatttgcaggtgacgacgttcacctgcggcggcttcgtgatcgggctgcgcaccaaccacgcggtggcggacggcaccggcgccgcccagttcatgaacgccgtcggcgacctcgcccgcggcctcccggagccgcgggtgaagccgatctgggcgcgcgaccgcttcccggacccggacatcaagcccggcccgctgccggagctccccgtgctgccgctccagtacatcgccttcgacttccccgccgcctacctcggcaagctcaaggcgcagtacgccgccaccgccggcgccagcaagatctgctccgccttcgacatcgtcatcgccaagctctggcagtgccggacgcgcgccatcgccgccgaccccgccgcggccgtcaagctctgcttcttcgccagcgcccgccaggtgctcggcctggagaccggctactggggcaacgccatcttcccggtgaaggtgtccgcggcggcgggggaggtggcggcgtcgtcggtgatcgagctcgtcggcgtggtccgggaggcgaagcggcggatggccggcgagtgcctgcgctgggcggaggggcgcaccggcggcgccgacccgttccagatgacgttcgactacgagtccgtgtacgtgtcggactggagcaagctcgggttcaacgacgtcgactacgggtacggcgcgccgtcggcggcggggccgctggtgaactgcgacctcatctcgtcggtgatcgtcatgcgggcgccggcgccgctcgccggcacgcggctgctggcgagctgcgtcaccaaggagcacgccgacgacttcgccgccaggatgagggaggatctcgtctaa</cdnaseq> |
| Protein Sequence |
<aaseq>DLQVTTFTCGGFVIGLRTNHAVADGTGAAQFMNAVGDLARGLPE PRVKPIWARDRFPDPDIKPGPLPELPVLPLQYIAFDFPAAYLGKLKAQYAATAGASKI CSAFDIVIAKLWQCRTRAIAADPAAAVKLCFFASARQVLGLETGYWGNAIFPVKVSAA AGEVAASSVIELVGVVREAKRRMAGECLRWAEGRTGGADPFQMTFDYESVYVSDWSKL GFNDVDYGYGAPSAAGPLVNCDLISSVIVMRAPAPLAGTRLLASCVTKEHADDFAARM REDLV</aaseq> |
| Gene Sequence |
<dnaseqindica>1..846#gatttgcaggtgacgacgttcacctgcggcggcttcgtgatcgggctgcgcaccaaccacgcggtggcggacggcaccggcgccgcccagttcatgaacgccgtcggcgacctcgcccgcggcctcccggagccgcgggtgaagccgatctgggcgcgcgaccgcttcccggacccggacatcaagcccggcccgctgccggagctccccgtgctgccgctccagtacatcgccttcgacttccccgccgcctacctcggcaagctcaaggcgcagtacgccgccaccgccggcgccagcaagatctgctccgccttcgacatcgtcatcgccaagctctggcagtgccggacgcgcgccatcgccgccgaccccgccgcggccgtcaagctctgcttcttcgccagcgcccgccaggtgctcggcctggagaccggctactggggcaacgccatcttcccggtgaaggtgtccgcggcggcgggggaggtggcggcgtcgtcggtgatcgagctcgtcggcgtggtccgggaggcgaagcggcggatggccggcgagtgcctgcgctgggcggaggggcgcaccggcggcgccgacccgttccagatgacgttcgactacgagtccgtgtacgtgtcggactggagcaagctcgggttcaacgacgtcgactacgggtacggcgcgccgtcggcggcggggccgctggtgaactgcgacctcatctcgtcggtgatcgtcatgcgggcgccggcgccgctcgccggcacgcggctgctggcgagctgcgtcaccaaggagcacgccgacgacttcgccgccaggatgagggaggatctcgtctaatataccatggccgcccccaataacattattagtcacgtacaatattgtcactgaatattaatttgttcgtgtatatctattgtggtatgtattttttttttcataggaaaaaagtagtagtacgacaataggtagctgggagctacctaatatcgacctctggtttgagagtaagtgagcgagcgagagatgtaaaccacctcagtttttaccgtgctttgtgacatgcgtggtacagtactggtactattaatcattggccgtgaaaaattatctaccc</dnaseqindica> |
| External Link(s) |