Os04g0615000

From RiceWiki
Revision as of 14:46, 20 May 2014 by Jiangnanji (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Nal1 affects rice auxin polar transportation and plays an important role in the lateral growth of blade because of adjusting arrangement mode of the tube bundle. Besides, Nal1 influence rice internodes cell division. Nal chromosome 1 in 4, the length of 2168 bp cDNA, contains five exons and encoding a 582 amino acid composition of protein. Nal1 mutant: a lack of exon 4 30 bp sequence. Nal1 encoding a plant protein, the biochemical function of the unknown, locating in the nucleus and cytoplasm. Nal1 expressed in leaf sheath, leaf, stem and young ear, in situ hybridization showed that Nal1 expressed in vascular tissue volume and high; Nal1 mutation significantly reduced the auxin polar transport activity, suggests that Nal1 affected rice auxin polar transport; Nal1 mutation after narrow leaves, leaf number of vascular bundles, reducing the number of vascular bundle arrangement change, d Nal1 adjust tube bundle arrangement mode, will play an important role in the lateral growth of blade; Reduced Numbers of nal1 internode of mutant cells, internodes shorter, plant height, so that nal1 rice internodes cell division. Rice flag leaf width of main effect QTL qFLW4 fine positioning shows that may be caused by the variable shear NAL1 gene (Chen et al. 2011).

Expression

nal-1 localized in chromosome 4, the length of its cDNA is 2168 bp. It contains five exons and encoding a protein with 582 amino acid.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Hu Peisong personal homepage:http://www.zoominfo.com/p/Hu-Peisong/209130130

References

1. Mingliang Chen;Ju Luo;Gaoneng Shao;Xiangjin Wei;Shaoqing Tang;Zhonghua Sheng;Jian Song;Peisong Hu

 Fine mapping of a major QTL for flag leaf width in rice, qFLW4, which might be caused by alternative splicing of NAL1
 Plant Cell Reports, 2011, 31(5): 863-872 

2. Jing Qi;Qian Qian;Qingyun Bu;Shuyu Li;Qian Chen;Jiaqiang Sun;Wenxing Liang;Yihua Zhou;Chengcai Chu;Xugang Li;Fugang Ren;Klaus Palme;Bingran Zhao;Jinfeng Chen;Mingsheng Chen;Chuanyou Li

 Mutation of the Rice Narrow leaf1 Gene, Which Encodes a Novel Protein, Affects Vein Patterning and Polar Auxin Transport
 Plant Physiology, 2008, 147(4): 1947-1959

3. McSteen, P. (2010). "Auxin and monocot development." Cold Spring Harbor perspectives in biology 2(3): a001479. 4. Wu, C., et al. (2010). "Isolation and characterization of a rice mutant with narrow and rolled leaves." Planta 232(2): 313-324. 5. Ding, X., et al. (2011). "Evaluation of near-isogenic lines for drought resistance QTL and fine mapping of a locus affecting flag leaf width, spikelet number, and root volume in rice." Theoretical and applied genetics 123(5): 815-826. 6. Peer, W. A., et al. (2011). "Seven things we think we know about auxin transport." Molecular Plant 4(3): 487-504. 7. Griffiths, H., et al. (2013). "You're so vein: bundle sheath physiology, phylogeny and evolution in C3 and C4 plants." Plant, cell & environment 36(2): 249-261.

Structured Information

Gene Name

Os04g0615000

Description

Hypothetical protein

Version

NM_001060401.1 GI:115460531 GeneID:4336986

Length

2575 bp

Definition

Oryza sativa Japonica Group Os04g0615000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:31610701..31613275

Sequence Coding Region

31611375..31611492,31611830..31612335

Expression

GEO Profiles:Os04g0615000

Genome Context

<gbrowseImage1> name=NC_008397:31610701..31613275 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:31610701..31613275 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtttcatccattaccacccaatcttgggcctggcgtttatcttggagctgttgaaagagcaacttctttcatcacagatgacgtttggtatggaatctatgctggaacaaacccagagacatttgtacgagctgacggtgcatttatcccatttgctgatgactttgacatttccaccgtcacgactgtagttaggggagtcggtgacattggggatgtcaaggttatagatctgcagtgtccgctcaatagcctcatagggaggcaagtatgcaaagttggcagaagctctggtcacacaactgggactgtgatggcctatgcccttgagtacaatgacgagaaaggaatatgcttcttcacagacatccttgttgttggtgagaaccgccaaacatttgatttggaaggtgatagcggaagccttattatcctgactagccaagatggtgagaagccgcgtccaattggaattatatggggtggcacagcaaatcgtgggaggttgaagcttacaagtgatcatggccctgaaaactggactagtggggttgatcttggccgtctactcgaccgtctggaacttgatattatcattaccaatgaatcactccaaggttga</cdnaseq>

Protein Sequence

<aaseq>MFHPLPPNLGPGVYLGAVERATSFITDDVWYGIYAGTNPETFVR ADGAFIPFADDFDISTVTTVVRGVGDIGDVKVIDLQCPLNSLIGRQVCKVGRSSGHTT GTVMAYALEYNDEKGICFFTDILVVGENRQTFDLEGDSGSLIILTSQDGEKPRPIGII WGGTANRGRLKLTSDHGPENWTSGVDLGRLLDRLELDIIITNESLQG</aaseq>

Gene Sequence

<dnaseqindica>675..792#1130..1635#caagattcatcgcaagatttgctagtacaaagtggataaattttcatggcactctgaagattatgccaaaaactgaccgttggtttgttggttagtcctaacatctaagtttgaccagttgagcggtggccacagctagtttgaatgctaccaatgttcattacatcaaagcagatgatctgatcggagattggaaggagtttctccttctaaatcatatcatatcatttgagatactgcatactatatgttggttcttgtgcagattaaagcttctggattttacacaatcctcctaccgtttaccagtcaaacctttaacatgttgctgtgctctttttgtgaaatttcaacttagtaataatattttgtgacatgcactcaaactacatactccctccatcccaaaaaaatccaacctaggataggacaacaaatctggacaaacactttgtccagatttgctgtgacctatcctaggttgttcttttttgggacggatggagtacttctgaagcgttcgtccttatagttctgtttcattgtttcaggttgcaagccatgaaacttttggtactttgggtgcaattgtgaaacggcgcactggcaacaagcaggttggtttcctcactaaccatcatgtcgcggttgacttggactaccctaatcagaagatgtttcatccattaccacccaatcttgggcctggcgtttatcttggagctgttgaaagagcaacttctttcatcacagatgacgtttggtatggaatctatgctggaacaaacccaggtagagcagttacaaattagctggtcagggctttatctacaattgtttgtctatttaaaaacaatgtcttaagtaacattaaaagacacttcaactcactgtataaatataaaaaataagtttcctgcttcctagttcccatcattcatattaatgccggattgcattttttactagttagaaacaaatcaacatttagttttgattgtaaaaaaaacatactatgtttgtgcttttctggtcatttaacacatttaccattttattgattattccaaatgatgtatataccagtctaattcccaaacatatatgccgccccattatggatttgcagagacatttgtacgagctgacggtgcatttatcccatttgctgatgactttgacatttccaccgtcacgactgtagttaggggagtcggtgacattggggatgtcaaggttatagatctgcagtgtccgctcaatagcctcatagggaggcaagtatgcaaagttggcagaagctctggtcacacaactgggactgtgatggcctatgcccttgagtacaatgacgagaaaggaatatgcttcttcacagacatccttgttgttggtgagaaccgccaaacatttgatttggaaggtgatagcggaagccttattatcctgactagccaagatggtgagaagccgcgtccaattggaattatatggggtggcacagcaaatcgtgggaggttgaagcttacaagtgatcatggccctgaaaactggactagtggggttgatcttggccgtctactcgaccgtctggaacttgatattatcattaccaatgaatcactccaaggttgattcttttccctctattcatttgcattcatcttcagatattccagaaatacgttggactatccaatttacttgatgttttcatactactttgtattgaatctgtacacttttgctccattacaaagctgacagaatttgcctactataaagatgccgtgcagcagcaaagatttgctttggtggccgccgttacctcagctgttggggagtcttccggggtgcctgtcgccatcccggaagagaagatcgaagagatcttcgagccattggggatccaaatccagcaactgcctcgccatgacgtggcggcctctggaactgaaggggaggaggcatccaacacggtggtcaatgtggaagagcaccagttcatctcaaacttcgtcggtatgtcgcccgtgcgcgacgaccaagacgctccgaggagcatcaccaacctgaacaacccctccgaggaagaactcgccatgtcgctccatctgggtgaccgagagcccaagcggctccgttcggactccggatcaagccttgacctggagaaatgaagtgcaaaaagtgctggttctgaatttctgattctggttcttcagagtttattgtcattgtggacagccaaaagtagtagtagatcaaaagacctcatatgcagttcagaaaaattgaacctgcagtaagcttcggtgagcttgaatggctttggcaagcatatcatgtaacatgatgtattattattactacaattgattcagccccttgtaggatgttaggtgctagtcctgcagttttgctgtgctcatgatcgtgagacctgatatacaccattgccggatcccttcctctttgtagaagaagaagaacaatgtgcagggaattatgataatgatgatctttgatctatttccccctattattatttaccaattatcaggtttcaattatc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0615000, RefSeq:Os04g0615000