Os01g0797600

From RiceWiki
Revision as of 06:02, 25 May 2014 by Zhangs (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

  • OsERF3 (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.[1]
  • OsERF3 (Os01g0797600) belongs to class II ERFs with a conserved EAR-motif (DLNRPPP) at the C terminal (Nakano et al. 2006). In rice, OsERF3 participated in the resistance to disease and the herbivore-induced defense responses via mediating different hormone pathways (Luet al. 2011).We also found that OsERF3 negatively

affected ethylene production and drought tolerance in rice(Wan et al. 2011). However, little is known about whether its EAR motif is involved in the regulation of ethylene synthesis and drought response. Here, we generated transgenic rice overexpressing full-length (OE) and the mutation of OsERF3 with the A680/C substitution (mEAR), respectively. The phenotypic analyses suggested that mEAR lines showed better drought tolerance and more ethylene emission than those of OE lines and wild type (WT) plants. At the transcriptional level, the substitution of Leu/Ala disrupted the repression of ACO2 and ACS6 by OsERF3 in mEAR lines. Moreover, ACS2 was significantly up-regulated in mEAR lines compared with that in WT plants. Taken together, our results indicate that the EAR motif is required for OsERF3 to repress the expression of ethylene biosynthesis genes, deepening our understanding of the regulatory function of ERF proteins involved in ethylene biosynthesis and stress response.[2]

  • OsERF3 is a transcriptional repressor with an ethylene-responsive element-binding factor-associated amphiphilic repression (EAR) motif (F/LDLNxxP), which transcriptionally represses the ethylene emission and drought tolerance in rice. However, its molecular mechanism to explore repression function remains unknown.[2]

Expression

  • The expression of OsERF3 was induced by drought, salt, ACC and ABA treatment. In addition, it showed a higher expression level in the root and sheath than that in the leaf.
  • The full length of OsERF3 gene was obtained from the cDNA library using specific primers.The full length of OsERF3 gene was obtained from the cDNA library using specific primers. The mutation of EAR motif of OsERF3 (mEAR) was obtained by replacing the base of A680 with C (Fig. 1a) through PCR amplifications using specific primers (Table S1). Then, the full-length cDNA of OsERF3 and mEAR were inserted into pCAMBIA1307 modified from pCAMBIA1300, respectively. For the modification of pCAMBIA1307 vector (Fig. S1), we inserted a fragment including a CaMV 35S promoter and multiple cloning sites from vector pBluescript into the SstI and KpnI of pCAMBIA1300 vector. To generate the ERF3:GUS construct, the 1.0 kb promoter region upstream to start codon of OsERF3 was amplified using specific primers (OsERF3P-F and OsERF3P-R) (Table S1). Then, the fragment digested with EcoRI and NcoI was cloned into the multiple cloning sites of pCAMBIA1391Z vector. All of the transgenic rice plants were generated through Agrobacterium-mediated transformation. T1 seedlings were examined by PCR amplifications at the DNA and RNA levels with specific primers (Table S1); T2 and T3 seeds were screened by germinating with the selection of 50 ng/l hygromycin.
Fig. 1. Comparison of EAR motif and phylogenetic analysis of EAR motif containing ERF proteins from rice and Arabidopsis.

Mutation

The physiological analysesransgenic of rice overexpressing full-length OsERF3 (OE) and its mutation of EAR motif with the A680/C substitution (mEAR), showed that mEAR lines showed better drought tolerance and more ethylene emission compared with those of OE lines and wild type plants.However, the repression of OsERF3 was eliminated in mEAR lines. Specifically, ACS2 was up-regulated in mEAR lines compared with that in OE lines andWTplants, suggesting that the Leu/Ala substitution within the EAR motif resulted in loss of repression of OsERF3.theEARmotif is required for OsERF3 to transcriptionally regulate the ethylene synthesis and drought tolerance in rice, providing new insight to the roles of ethylene-response factor proteins in regulating ethylene biosynthesis and stress response.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Institute of Crop Sciences/National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing100081, China
  • Shenzhen Institute of Breeding and Innovation, Chinese Academy of Agricultural Sciences, Shenzhen 518083, China
  • Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing 100081, China
  • National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing 100081, China
  • Rice Institute, Hunan Academy of Agricultural Sciences, Changsha 410125, China

References

<references>

Structured Information

Gene Name

Os01g0797600

Description

Ethylene responsive element binding factor3 (OsERF3)

Version

NM_001051054.1 GI:115440478 GeneID:4327621

Length

1090 bp

Definition

Oryza sativa Japonica Group Os01g0797600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:35522840..35523929

Sequence Coding Region

35522920..35523627

Expression

GEO Profiles:Os01g0797600

Genome Context

<gbrowseImage1> name=NC_008394:35522840..35523929 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:35522840..35523929 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactag</cdnaseq>

Protein Sequence

<aaseq>MAPRAATVEKVAVAPPTGLGLGVGGGVGAGGPHYRGVRKRPWGR YAAEIRDPAKKSRVWLGTYDTAEEAARAYDAAAREFRGAKAKTNFPFASQSMVGCGGS PSSNSTVDTGGGGVQTPMRAMPLPPTLDLDLFHRAAAVTAVAGTGVRFPFRGYPVARP ATHPYFFYEQAAAAAAAEAGYRMMKLAPPVTVAAVAQSDSDSSSVVDLAPSPPAVTAN KAAAFDLDLNRPPPVEN</aaseq>

Gene Sequence

<dnaseqindica>81..788#cacacccaaacccaacctcccaaaacacccacccggtttaccagagatccgcgcccgccacttgtaaacctgctgcacccatggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactagctcaggatgggttagctgacgactttgtagtttctctcttattttcttctttgatggatatttctctccgatgttttggtcctctgtgtttttgtttagtagcctgtgagagacggaagagccttgtaaatagtttttctgccgagggcgaaattcatcttgggatctgttaattagaacagatcatgccggcgatgagatggactaaaccgtggagtgtatgtattcctttatattagtatgaagaaattattcagaaagtcacaaaaatatctgtgcacactgagtttgattgacgtttt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0797600, RefSeq:Os01g0797600

  1. 1.0 1.1 Zhang et al. BMC Genomics 2012, 13:461.Fan Zhang, Liyu Huang, Wensheng Wang, Xiuqin Zhao, Linghua Zhu, Binying Fu and Zhikang Li;Genome-wide gene expression profiling of introgressed indica rice alleles associated with seedling cold tolerance improvement in a japonica rice background
  2. 2.0 2.1 2.2 Haiwen Zhang • Jianfei Zhang • Ruidang Quan •Xiaowu Pan • Liyun Wan • Rongfeng Huang;EAR motif mutation of rice OsERF3 alters the regulation of ethylene biosynthesis and drought tolerance. Planta (2013) 237:1443–1451