Os05g0107700

From RiceWiki
Revision as of 12:47, 27 May 2014 by Pxaricewiki2013 (talk | contribs) (Expression)
Jump to: navigation, search

Os05g0107700 is a recessive gene associated with resistance to rice bacterial blight.

Function

Os05g0107700 represent gene xa5. The gene xa5 provides racespecific resistance to X. oryzae pv. oryzae, and encodes the small subunit of transcription factor IIA(TFIIAγ). This recessive gene provides race-specific resistance to X. oryzae pv. oryzae, and is structurally unlike the more than 40 plant R genes previously cloned. xa5 is inherited in a completely recessive manner and the susceptible allele Xa5 is fully dominant. xa5-mediated recessive resistance is the result of restricted bacterial movement, but not restricted multiplication.

Plants with lesions less than 4 cm are resistant, while those greater than 4 cm are susceptible. The susceptible indica isoline IR24 and the resistant indica isoline IRBB5 were referred to as IS and IR respectively. No significant difference in lesion length between IS and heterozygous F2s 14 dpi was observed. In addition, bacterial populations over time in heterozygous plants were similar to those in homozygous susceptible IS individuals. These results demonstrate that the Xa5 allele is not dose-dependent in the indica IR24 background.

Although X. oryzae pv. oryzae multiplied extensively in resistant IR lines, lesion lengths were consistently less than 4 cm. Genetic background may play a role in resistance mediated by specific Xa genes. X. oryzae pv. oryzae -xa5 dynamics appear to differ in the indica and japonica NILs. Bacterial movement is restricted in both indica and japonica resistant plants. In both indica and japonica NILs, X. oryzae pv. oryzae movement down the leaf was dramatically faster in susceptible than in resistant leaves. Movement in resistant leaves appeared to be more restricted in JR than IR.

No significant difference between untransformed susceptible japonicas(JS) and Xa5 transformed previously resistant japonicas (JR::Xa5) was observed. In the japonica subspecies as in the indica, xa5 operates as a recessive gene and genetic background does not affect its gene action. Since the transgenic JR::Xa5 plants contain two copies of the recessive resistant xa5 allele, one allele of Xa5 is sufficient for disease even in plants with two copies of xa5. Additional insertions of Xa5 do not result in increased disease severity in previously resistant genotypes,suggesting that Xa5 may be a susceptibility allele(Iyer-Pascuzzi et al., 2008).

Expression

The rice xa5 gene for disease resistance to Xanthomonas oryzae pv. oryzae has been positionally cloned and encodes the gamma subunit of transcription factor IIA (TFIIAγ). TFIIAγis a general eukaryotic transcription factor with no previously known role in disease resistance. xa5 is unusual in that it is recessive and does not conform to one of the typical resistance gene structural classes. Sequencing of TFIIAγ in resistant and susceptible isolines revealed two nucleotide substitutions resulting in an amino acid change between resistant and susceptible cultivars. This association was conserved across 27 resistant and nine susceptible rice lines in the Aus-Boro group.

Positional cloning identifies xa5 in an 8.1-kb region containing TFIIAγ in the subtelomeric region of chromosome 5. The start codon, splice junctions, and 3′UTR of the TFIIγgene were defined by aligning a Nipponbare TFIIAγ cDNA (GI 32975200) to the IR24 (susceptible) BAC. This identified two nucleotide substitutions resulting in an amino acid substitution from valine to glutamic acid at position 39 in the resistant cultivar, a significant change from a hydrophobic to hydrophilic amino acid. Examination of the structure of TFIIAγ further showed that the variable amino acid at position 39 resided in a solvent-exposed surface, suggesting that it may play a role in protein-protein interactions (Bleichenbacher et al., 2003).This single amino acid change in TFIIAγ is consistent with the stable expression of this gene in both susceptible and resistant plants and leads to the hypothesis that it functions both as general transcription factor and as xa5.

A single resistant haplotype conserved across all 27 resistant lines was found. There were two haplotypes among the 11 susceptible accessions, each of which carried nucleotides that would result in a valine at position 39. The japonica Nipponbare as well as four of the Aus-Boro lines contained the same susceptible haplotype as IR24, while five Aus-Boro lines had a silent mutation within the coding region(Iyer and McCouch, 2004).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Plant Genome Mapping Laboratory, University of Georgia,Riverbend Research Laboratory, Room 162, Athens,GA 30602, USA

Institute of Genomic Diversity, Plant Breeding Department,130 Biotechnology Building, Cornell University, USA

CIAT - International Center for Tropical Agriculture,A. A. 6713, Cali, Colombia, South America

Central Rice Research Institute (CRRI), Cuttack 753 006, India

International Rice Research Institute (IRRI), Los Banos, Philippines

College of Life Sciences, Wuhan University,Wuhan, 430072, P.R. China

Department of Plant Breeding and Genetics, 240 Emerson Hall, Cornell University, Ithaca NY 14853, USA

References

A. S. Iyer-Pascuzzi;H. Jiang;L. Huang;and S. R. McCouch.Genetic and Functional Characterization of the Rice Bacterial Blight Disease Resistance Gene xa5. Phytopathology, 2008, 98(3): 289-295

Structured Information

Gene Name

Os05g0107700

Description

Transcription factor IIA small subunit (Transcription factor IIA gamma subunit)

Version

NM_001060961.1 GI:115461652 GeneID:4337575

Length

6227 bp

Definition

Oryza sativa Japonica Group Os05g0107700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:415085..421311

Sequence Coding Region

415426..415554,415649..415699,420795..420935

Expression

GEO Profiles:Os05g0107700

Genome Context

<gbrowseImage1> name=NC_008398:415085..421311 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:415085..421311 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataa</cdnaseq>

Protein Sequence

<aaseq>MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKS MTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSK LLSQ</aaseq>

Gene Sequence

<dnaseqindica>342..470#565..615#5711..5851#gtctcctccgctcctcctctccttgcgccaacaagccgactcgcgatctccatcgggcaagaagagcagagcagagcaggggaggggatcctgcaggtgaccatcctctttctttctttctttctttctctgaattcatctctctctctcccaccgggactctctacttttgtctggaatttgctcgcgttcgttcgttaaccctagcttctcttctcttctcttctagatctggaagaagctcttaatttcagagccttaacctctcttaatactacaagtaacaacagttttgttgtttgttccccccaccccaaaaagtttaggcgcacgcatcgcccatggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctcgacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccagtttgataaggtatctactttaccatatctccttccacctattactatctatactattgaaaaattcgactcctcattttgtttgttatcatctatgtgattagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaaggtatctgctcttatcacggagttgccatgttgctgttcctacccccccaaaaaaaaccaagccttacttgtgctgtgcataactttaatctctatctgtttcgagcctactcattatttatgcttgagaactcatatgcgcttgtgatgtaatttctccagtgctagaattgatacacttggttgtggattcagcgttgccattcgattttcttttccgtacacaccttgctaaaggaatcaagtctaaaatttgtttcttgcatatattatattattattattattcataaaggaatccattcacgttcgacacgtacctgtcctgtgtacgctgctctgagttctgagggatattgcacaaactttatagtaatgagtaagcgagtaacagaattaagacctatcagcaacataatacacgggcataaccagacaaatcttgcacttatcacatatatgcttttattttttcggctgtacaagcatatttccacttatcttattttgcaacacatcaagtactccttgagttgctcagattccaagctgctcatctgtgtttggccccaaaaaaaaagaaaagaaagaaaaaccttttattggataaacaagcctgagaaatgtcaagatcttttcttgccagcataatcctcaccaaaatgaaattatgaataaagattagtgtcattctttctgatacccatgtagtttgttattctatggcatgatagagattcttttttgtttgtgaattgggggtaatcacagaaatggactgatatttttgcccaacaatgggtgacttgtttacgtatcttactgtaatccgctttactcctggccccttgccccttttttataaatggaagtcaaaagtatgcaaaatataggcaactcgcacattacaatagcctcagaccctaactaccacatcgcaaccatgtgcgagttaggaatgccacacccggatgtgtgtcctctatgcgatcaggaggagactatacagcatattttggtgacttgtgttttttcctggcaagtatggtttttaatcttccaaatggttggatgggcgctgcagcactgcaaccatcaatgaatcgcttgtctagctggtggttcaaaacagttaaggatactcctaaagaggtaaagaaagggctgaactctttgattatcctagtggcatgggaaatatggaagcatcgcaatgattgtgtcttcaatggtgcctccccgagaatctcggctgttttgcatgcagtggctagagagagttctctttggtgtactgctggagcaaaggcactcctcgaaattctgtgtgggttgctccccctggacggctagtttctcctagggggtgtttcggttgcacgtcgcgttccgtgatgtttttttgtgtttctgtaggggtcctttgggtcactcggttgtacaatttctcttcttaatgaaatgaatcgcagtcctcctgtggtttcgagaaaaaaaaactcacacattgcaatattgcccatattaaaacactgatttttccccataaaccaaaacaagaaataaagtaactaagtgaccctggtgtgtacatgtttattagaacttctttatctgcaatattgtgcaagagaaacaagccgcaaacagcgttggagctcaataacaaaccagtaatgatgctagaaaccgtaccaaacataagacggtactctgctagaaaccttttttttttgtgccaagaagcgacttgaccactcaacatctcaatttcccttctgatcacaagcaatctagggctcatcgctgggttcgtacgataatcacacttccctgttctccattcttgtcatagttcagtgctctgctcctctaactgtgcttgtagtatcaatcagtcctctgggccattcgtagacgcaacaggcagctcaccaagttcgggtgaatcgttttgtcgtgtttattcttgtcccattagtcactagatagttcagcactgttcttgttattctattgatgcatttgtatatgactcattttcacgaaaggtgcatcaagagcattatattactgtagctatgtagttgttatcggtgagctttgctccatgctaaaagagttgggctaaatctatagcatttaagaattagttatagctggaaagatcatgtttgtcttgtagattcgactacctgatagcagctatccacctggatgatgaacagatctgtccatgacaacctgctgggctatggtgcatgcatgcacccatgtgataagtatgtaaaacgctatcctagatatagttttgcaagaattgatctctattgctaccggagactagaaaggtgttatggattggctagggcaagggtccgaagaccgggggatatagcactcgccctctaatagcagaggcagggcttctccctgctgagctaaaagaggctatgaggcttagggctaactttagagattcattgattgattgataagagtacatggggtcactttatatatagggaggacaggcttgacatccaaggaactaatctctagtactacagaaaccagtccaatctctatctctaactttctaataaacctcatctctttcctaattagataatctcctacctatatatgagtaattcgtaatttatgatgcctaaactgctgcatgggcctggtccatgcccataacactacacccctcgcggacagatagtcttcgagcactagcagatatcttcttggaaagaacttcaatggtagcagtcggcaaatcatcaaagcgaagtttgatatttttcttgagttctggccaagtttgaattccgtaggctcgctcaatcaactcataccacattgcggcaaacctggtccggtggcttgatgcaatccaccacttctcttcctccataaattcgctgctcaacaaagaactgctcaatactctccaaccaaatttgcggatcatcctcaccattgaacgttgggagaggttcaaggtggcgaaatctccacatccaattgaaatccccgctgcacgccatcgagggtggagcatcagttggctctgataccaaatgttatggattggctagggtaagggtgcaaagactgggggatagggcactcgccctctaatagcagaggcagggcttcttcctgctgagctaagaggctctgaggcctagggctagctttagagattcattgattgattgattgataatgcagtacgtgggacccctttatatatagggaggacaggcttgatatccaaggaactaatatctagtaccatagaaaccagtgcaatctctatctctaactttctaatagacctcatctctttcctaactagataatctcctacctttatatgagtaattcctaatttataatgcctaaactgctgcatgggcctggtccatgcccataacaaaaggaggtaaacgctatcttatagcttctaaatacggcacacctttatcatccatttctagttttggcttatggaaaaatcttcagttaaagcatttatgatattacaaaattgcagatgacgttttgtcggcatctgaactctcgtgaatctgctgcttgccccttcttagttgttccttaagttgtttcggcctttccaatttagcagtacacttaatcctcatgatccaaccatggccatcaattttcaattttcaactctgagcactctcgaccaatctcccatcagctgggacctattcagctgtctaagacatacattcacaaaggagattgcatgttctgattttcatttttacttgtaaaatgtaatgtttgcatagccattttgtatgtttagcctgaaaatggttgaagcatagttaccagttcatttgttttggtgttttacctgataatgtccagtgtatgaagacatgcgataattgataaattcatatatccggccactcttttacaactgtcactgtgtgggtttaagaaatccctcttttgacaaaccgcagttctctttttcttttccaaagaattgttaatcccacactgaattgctgtattaggaagggatcacctctacaatatgtcatttatgatatgtggtgttgagatgttacgtgttctgttttatttttgacgaaaatgcaggagaactggcattccattaaccattagctaagaaatgtacatggttttatcagtcataaactggacttactattttagaatcatgaactagagttttgctaatggaaattttaccattttaaaaatcatgaactggagtttgaattaatctctgttttatttatttttgagtaaatttcataaaactacatatactttgcatgatctatcacaaaactatagatttaagaacttatttcacaaaactacaaatttaatgtcttcgtttatcacaaaactacaggtattttacacaatatatcacaaaactacagatttaagaacttgtttcacaaaactacagatttaatatcttcatttatcataaaactacaggtttagtgtcttcattatcacaaaactacaggttttagcattgtcaaaacctgtagttttgtgataatggagacactaaatttgtagttttgtgataaatgaagacactaaatgtgtagtcctatgataaacgaatacactaattctatagttttgtgaaacaagttcttaaatctgtagttttgtgatagattgtacaaagtacctgtagttttgtgataaacgggcatactaaatctgtagttttgtgaaacaagctcttaaatctgtagttttgtgataaattgtgcaaaatacatgtagttttgtgaaatttactctttatttttctaacttgctatcctgctccagaaattttccattctagttacatgagtttaagcctcttgtcattttggacgcaatgtcgaacagacctgtatttgatggattttttttgtttatttaagaataagttctctggtacagcttagatacgatggatgattgactaactttttgagcctgtatttcagatattttgtagctgggctgtttactgatgcatgttcttttctcagggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagcatcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgattccaaactactcagccaataaattgataactgcgaggtcagggtttgcctggtatttgttagtctcttctgctagacctggctccgcctgaagtgtactgtaccaccacattgtttgtttcataatcaatgtgtgtcaatacaatcgtatgtgctaccagagtatatcacagcagcaactgttttaatttgtatgcttatgtaattgttatgctactgctgtgttgataatgtgatataaatgactaaacgatgagtagtagaaattgtgcggagtcaccctcccccttcctcatttctgaaccctttggttctgtgtgactctttgtatgtaacatgaacaaatacctcctttcccgtcttttttttggatcctatgttaatggtacctttacatt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0107700, RefSeq:Os05g0107700