Os03g0237250
Please input one-sentence summary here.
Contents
Annotated Information
Function
Loose Plant Architecture1,the functional ortholog of the AtIDD15/SHOOT GRAVITROPISM5 (SGR5) gene in Arabidopsis (Arabidopsis thaliana),regulates tiller angle and leaf angle by controlling the adaxial growth of tiller node and lamina joint. LPA1 was also found to affect shoot gravitropism.[1]
Mutation
Thelpa1 mutant was a naturally occurring mutant isolated from anindicavariety, Zhongxian3037. During both the vegetative and reproductive stages,lpa1 always exhibited loose plant architecture with larger tiller angle and leaf angle than those of the wild type (Fig.1, A and B).The tiller angle at heading date and found that the maximum angle was 17.3° inlpa1 but only 9.8° in the wild type (Fig. 1C). Careful observation showed that the large tiller angle of lpa1 was caused by the more symmetrical growth of the tiller node compared with the wild type (Fig. 1D).The leaf angles: each angle was larger in lpa1 than in the wild type, and this difference was more obvious in older leaves, where the maximum angle of the fourth leaf could reach up to 61.2° in lpa1 but only 27.4° in the wild type (Fig. 1E). This difference was further confirmed by the dynamic change observed in the newly developing leaf (Fig. 1F). Detailed examination revealed that the large leaf angle of lpa1 was caused by a more rapid elongation on the adaxial side of the lamina joint (Fig. 1, G and H).
In rice, the lazy1 mutant exhibits a tiller-spreading phenotype resulting from reduced shoot gravitropism [2]. To examine whether lpa1 was also involved in the same process, we analyzed the gravity response of young seedlings. The result revealed that both light- and dark-grown mutant seedlings had a reduced gravity response and could not grow upright eventually (Fig. 2, A–C). However,lpa1roots showed a normal gravity response (Fig. 2D). These results indicated thatLPA1is only involved in shoot gravitropism in rice.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
References
Structured Information
| Gene Name |
Os03g0237250 |
|---|---|
| Description |
Zinc finger, C2H2-type domain containing protein |
| Version |
NM_001186408.1 GI:297721946 GeneID:9270511 |
| Length |
837 bp |
| Definition |
Oryza sativa Japonica Group Os03g0237250, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:7289669..7290505 |
| Sequence Coding Region |
7289669..7290246,7290328..7290505 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</cdnaseq> |
| Protein Sequence |
<aaseq>MALVKSHHQMLASSSTSSSSPSSQQQQPPPPASNSSSLAAAAAD QPSPAKRKRRPPGTPDPDAEVVALSPRTLLESDRYVCEICGQGFQREQNLQMHRRRHK VPWRLVKRPAAATAAEDGGAAGGGGGAGGGAGGGGARKRVFVCPEPSCLHHDPAHALG DLVGIKKHFRRKHGGRRQWVCARCAKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRYV HHPLSSSSNLRSVHGGRRRMHYYYYVRTLTIHD</aaseq> |
| Gene Sequence |
<dnaseqindica>260..837#1..178#atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccaggtacgtatatacgtatgtgttggagacattgataccatcatgcatgcatggtgttcgatcatggagcccgtgtgtacgtagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Xinru Wu;Ding Tang;Ming Li;Kejian Wang;Zhukuan Cheng.Loose Plant Architecture1, an INDETERMINATE DOMAIN Protein Involved in Shoot Gravitropism, Regulates Plant Architecture in Rice. Plant Physiology, 2013, 161(1): 317-329
- ↑ 2.0 2.1 Li P, Wang Y, Qian Q, Fu Z, Wang M, Zeng D, Li B, Wang X, Li J(2007)LAZY1 controls rice shoot gravitropism through regulating polar auxin transport. Cell Res 17:402–410
