Os09g0466400

From RiceWiki
Revision as of 01:56, 29 May 2014 by 马爱民 (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells[1].

Expression

qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. We also speculated that it was involved in panicle development(Fig. 1k)[1].

File:Mam123

Brief introduction to ZF-HD transcription factor gene family

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4]. Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses. PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

ZF-HD members in rice

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1 LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1 LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1 LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067 BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924 BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752 BGIOSGA034224 BGIOSGA034718 BGIOSGA036923


You can also add sub-section(s) at will.

Labs working on this gene

National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University..

References

[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.


Structured Information

Gene Name

Os09g0466400

Description

Similar to ZF-HD homeobox protein

Version

NM_001069954.1 GI:115479650 GeneID:4347315

Length

1169 bp

Definition

Oryza sativa Japonica Group Os09g0466400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:18357788..18358956

Sequence Coding Region

18358047..18358886

Expression

GEO Profiles:Os09g0466400

Genome Context

<gbrowseImage1> name=NC_008402:18357788..18358956 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:18357788..18358956 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatga</cdnaseq>

Protein Sequence

<aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIG SRVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNF HRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAA AAGGYPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRF RTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK KLP</aaseq>

Gene Sequence

<dnaseqindica>71..910#aagtgttttcctagctaggtagctagctagctagacaagcttgccggccggccggccggcgacggcgaccatggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatgaccgggagcaaatgcatttgatctcatcgtcggcatgcatgaccaagttgtgggacgacgcatgcatccatgtccatcccaagctagctgagctgatcgaccggccgtggcttagccacccggaccccggtatggtaggtacctgaaccttatttatttagagttggacttaattaattggtggcttaggttaatctgtagcaagagagactgagagagcattcgttctcggctctagtaggtggttctttcttcttttc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0466400, RefSeq:Os09g0466400