Os01g0897700

From RiceWiki
Revision as of 03:42, 1 June 2014 by Tina (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain[1].Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4, OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3]. Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation[1].Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition. OsFH1-1.png

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0897700

Description

Similar to FH protein NFH1

Version

NM_001051625.1 GI:115441620 GeneID:4325107

Length

1054 bp

Definition

Oryza sativa Japonica Group Os01g0897700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:40769673..40770726

Sequence Coding Region

40769990..40770463

Expression

GEO Profiles:Os01g0897700

Genome Context

<gbrowseImage1> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttga</cdnaseq>

Protein Sequence

<aaseq>MDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAWRFHDSMQ KFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQ VCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP</aaseq>

Gene Sequence

<dnaseqindica>264..737#atcgcggcgatgcacacgcgttcaagcttgatactctactcaaattggttgatgtcaaaggcactgatggcaagactacacttttgcattttgtcgtgcaggagattatccgaacggagggctcccacctctctgctagcaaccaatcaactccacgaactcaggcaaaccctttacgggacgagctcgagtgcaaaaagcttggcctccaggtagtggctggcctcggaaacgagctcagcaatgtcaagaaggcagctgccatggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttgatcaccagtagtctgccaatagaaatttttcgcagagtactgtgggaaacctccatagggcagagggagaccaacggcgacggggtgtcaaatttttttttgaaccttttgtacctgtagattatagaatgtaagaagtttttttgcaaatatttatttctatatataagaggagataaaatctagatcagaggaggaaataagcagttcatgtgtttgtcatcttcagtctgtacatgacacgaggtagtgaaacagcctgtacaatgtactaacaatttcaagtatggccagtctgcagaattcaaaggtaagctg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0897700, RefSeq:Os01g0897700