Os04g0572400
Please input one-sentence summary here.
Contents
Annotated Information
Function
Most dehydration-responsive element-binding (DREB) factors interact specifically with the dehydration-responsive element (DRE) and control the expression of many stress-inducible genes in Arabidopsis. OsDREB are homologous to Arabidopsis DREB genes. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners (Chen et al. 2008).
OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element. OsDREB4-1 and OsDREB4-2 proteins specifically bound to DRE and activated expression of the dual reporter genes of histidine (HIS3) and galactosidase (LacZ). OsDREB4-1 could function as a trans -acting factor in the DRE/DREB regulated stress-responsive pathway. The expression of the OsDREB genes could be controlled by specific aspects of differentiation or development (Tian et al. 2005).
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1. Department of Plant Science, College of Biological Sciences, China Agricultural University, Beijing 100094, China;
2. Plant Biotechnology Laboratory, Institute of Genetics and Developmental Biology, the Chinese Academy of Sciences, Beijing 100101, China
3. College of Life Sciences, Beijing Normal University, Beijing 100875, China
4. chool of Life Sciences, Fudan University, Shanghai 200433, China
5. National Center for Molecular Crop Design, Weiming Kaituo Agriculture Biotech Co., Ltd, Beijing 100085 ,China
References
1. Chen J Q, Meng X P, Zhang Y, et al. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice[J]. Biotechnology letters, 2008, 30(12): 2191-2198.
2. Tian X H, Li X P, Zhou H L, et al. OsDREB4 Genes in Rice Encode AP2‐Containing Proteins that Bind Specifically to the Dehydration‐Responsive Element[J]. Journal of Integrative Plant Biology, 2005, 47(4): 467-476.
Structured Information
| Gene Name |
Os04g0572400 |
|---|---|
| Description |
Similar to CRT/DRE binding factor 1 |
| Version |
NM_001060143.1 GI:115460015 GeneID:4336721 |
| Length |
660 bp |
| Definition |
Oryza sativa Japonica Group Os04g0572400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:29219354..29220013 |
| Sequence Coding Region |
29219354..29220013 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MEWAYYGSGYSSSGTPSPVGGDGDEDSYMTVSSAPPKRRAGRTK FKETRHPVYKGVRSRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAAMALRGR AACLNFADSPRRLRVPPLGAGHEEIRRAAVEAAELFRPAPGQHNAAAEAAAAVAAQAT AASAELFADFPCYPMDGLEFEMQGYLDMAQGMLIEPPPLAGQSTWAEEDYDCEVNLWS Y</aaseq> |
| Gene Sequence |
<dnaseqindica>1..660#atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</dnaseqindica> |
| External Link(s) |