OrfB
Please input one-sentence summary here.
Contents
Annotated Information
Function
It is generally believed that the CMS trait is associated with mitochondrial DNA (mtDNA) rearrangements, which result from the expressions of chimeric open reading frames (orf) or alterations in genomic structure and transcriptions patterns of mitochondrial genes [1].
Mutation
Experimental evidence for polymorphisms in orfB structural organization and mitochondrial transcript profiles of the orfB gene in the CMS-WA rice system. The sterile line orfB gene transcript profile was characterized by two transcripts of ~1.1 kb and ~0.7 kb, and one ~0.7 kb transcript was detected in the fertile lines. The ~1.1 kb transcript present in the sterile line remained unedited. However, in the presence of nuclear encoded restoration of fertility (Rf) gene(s) in fertile restored hybrid lines (APMS-6A × BR-1870; F1 generation), the ~1.1 kb orfB transcripts were fully edited. The editing of the orfB gene ~1.1 kb transcript co-segregated with fertility restoring alleles in a segregating population of F2 progeny of restored hybrid F1 plants.[2] RFLPs were observed for the orfB gene in the mitochondrial genome between the sterile and the fertile lines,showing that mitochondrial orfB gene was present as a single copy with differential organization in the sterile and fertile lines. Mitochondrial RNA editing of the orfB transcript was assessed in the fertile rice line. Fourteen cDNA clones obtained from cDNA library of fertile rice line were sequenced. Determination of the orfB cDNA sequence from overlapping clones from the cDNA library showed four C→T conversions within the coding region relative to the orfB genomic sequence. Two editing events within the coding region affected the second position in a codon (200th and 443rd), and another event changed the first position (58th). These three editing events altered the coding properties of the affected triplets, which led to major changes in amino acids [Leu→Phe (20th), Ser→Leu (67th) and Pro→Leu (148th)]. Furthermore, editing at nucleotide position 200 in the coding region of orfB disrupted an XhoI restriction site (CTCGAG to CTTGAG). The fourth substitution was at the third position of a codon for leucine and was silent (Figure 4). Results showed that all four sites within the coding region were edited in all 14 clones. This indicated highly efficient and consistent mitochondrial editing for this transcript in the fertile rice line. (b) The sterile line orfB cDNA sequences were determined from overlapping clones of the cDNA library from the sterile rice line. Twelve orfB cDNA clones were completely sequenced. The size of the inserts ranged from 647 bp to 230 bp. Analysis of the clones revealed that they comprised sequences that overlapped with each other and were homologous to the nucleotide sequence of orfB cDNA from the fertile line (Figure 4). However, in contrast to the cDNA clones from the fertile line, unedited as well as edited cDNA clones were obtained from the sterile line. The edited clones exhibited identical editing to the cDNA clones in the fertile line. Interestingly, however, in the clone with the largest insert (6A25-11) editing was absent. Sequence analysis also indicated the insert contained a portion of the 5’ UTR region of the orfB gene, not detected in 0.7 kb orfB gene transcripts of the fertile lines. It was therefore inferred that the clone contained an insert originating from the long 1.1 kb transcript of the orfB gene. Furthermore, an additional interesting clone (6A21-61) of 230 bp was detected. It contained three unedited sites; unlike the other two clones that contained one unedited site out of four, normally found edited within the orfB gene coding sequence (CDS). abserving that some of the orfB gene transcripts in the sterile line remain unedited appeared significant.
Expression
Editing of the orfB transcripts (a) The fertile line Mitochondrial RNA editing of the orfB transcript was assessed in the fertile rice line. Fourteen cDNA clones obtained from cDNA library of fertile rice line were sequenced. Determination of the orfB cDNA sequence from overlapping clones from the cDNA library showed four C→T conversions within the coding region relative to the orfB genomic sequence.
Evolution
Knowledge Extension
Please input evolution information here.
You can also add sub-section(s) at will. orfB transcripts of the sterile line have identical 3’ ends with that of transcripts from the fertile lines The basis of the observed differences in the orfB gene transcripts between the sterile and fertile lines was determined using 3’ RACE. The forward primer OGSP1 (Figure 4) annealed 180 bp downstream of the initiation codon in the coding region of the orfB gene. In both the fertile and sterile rice lines, one amplified band of ~400 bp was obtained
Labs working on this gene
Please input related labs here.
References
Please input cited references here. <references> [2]
| Gene Name |
orfB |
|---|---|
| Description |
ORFB protein |
| Version |
GeneID:6450152 |
| Length |
468 bp |
| Definition |
Oryza sativa Japonica Group orfB, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:53424..53891 |
| Sequence Coding Region |
53424..53891 |
| Genome Context |
<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq> |
| Gene Sequence |
<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica> |
| External Link(s) |