Os04g0271200

From RiceWiki
Revision as of 08:16, 8 June 2014 by Shfengna (talk | contribs) (Expression)
Jump to: navigation, search

Os04g0271200 is reported as SRT701and SRT702.

Annotated Information

Function

  • Histone modifications including acetylation, methylation, phosphorylation, ubiquitination and others are shown to play an important role in chromatin function and gene regulation. The homeostatic balance of nucleosomal histone acetylation is maintained by antagonistic action of histone acetyltransferases (HAT) and histone deacetylases (HDAC). Plant HDAC can be grouped into four classes. Among them, three have primary homology to three yeast HDAC groups: RDP3, HDA1 and SIR2.[1]
  • The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD +-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1].
  • The SIR2 family has two members in rice: SRT701 and SRT702.[2]
  • The two proteins are likely to have distinct functions, as SRT701 (OsSRT1) is nuclear localized and is shown to be involved in histone H3K9 deacetlyation required for transposon repression in rice[1], whereas SRT702 is recently shown to be localized in the mitochondria.[3]
  • SRT701 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of SRT701 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that SRT701 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by SRT701. Rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth.[1]
  • SRT702 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport.SRT702 is important in fine-tuning mitochondrial energy metabolism.[4]

Expression

  • SRT701 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues.[3]
  • It has highest levels in active cell dividing organs/tissues. Down-regulation of SRT701 by RNAi induced lesion mimic cell death and precocious senescence, whereas overexpression showed tolerance to oxidative stress. [3]
  • Cell death was induced in OsSRT1 RNAi plants. Cell death in the SRT701 RNAi plants also resembled hypersensitive response-mediated PCD. Either both types of PCD were induced by SRT701 down-regulation, or different triggers of PCD may be interdependent in plants and the downstream effectors of PCD may be shared among different pathways.[3]
  • Western-blot analysis of enriched histone fractions detected a decrease of H3K9 acetylation in overexpression plants (Fig. 6B). The overexpression plants showed no particular visible or morphological phenotype. However, when treated with paraquat (1,1′-dimethyl-4,4′-bipyridylium), an herbicide that induces oxidative stresses in plants, the overexpression plants showed an enhanced tolerance compared to the wild type, as demonstrated by fewer and smaller lesions observed on the overexpression plants than the wild type.[1]

F1.medium.gif[5] F6.small.gif[1] 1-s2.0-S0006291X09015459-gr1.jpg[2]

Evolution

  • Plant histone deacetylases (HDAC)can be grouped into four classes. Among them, three have primary homology to three yeast HDAC groups: RDP3, HDA1 and SIR2.During the last years, HDAC function has been most studied in Arabidopsis.[2]
  • The function of SIR2 family HDACs was first been investigated in Arabidopsis. The Arabidopsis genome encodes two SIR2 family HDACs: SRT1 and SRT2. SRT2 resides predominantly at the inner mitochondrial membrane and interacts with a small number of protein complexes mainly involved in energy metabolism and metabolite transport[3].
  • SRT701(OsSRT1), one of the two SIR2-related genes found in rice, has been studied in Huang et al and proved its' function[1], while SRT702's function has been studied in Arabidopsis.[4]

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University,Wuhan 430070, China (L.H., Q.S., F.Q., C.L., Y.Z.)
  • Department of Quartermaster,Military Economy Academy, Wuhan 430035, China (L.H.)
  • Institut de Biotechnologie des Plantes, Universite´ Paris Sud 11, 91405 Orsay, France (D.-X.Z.)
  • Department I of Biology, Ludwig Maximilians University Munich, Grosshaderner Strasse 2, 82152 Martinsried, Germany.
  • Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou 510650, China
  • Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of
  • Institute of Plant Biology, National Taiwan University, Taipei
  • University of Chinese Academy of Sciences, Beijing 100049, China
  • Institut de biotechnologie des Plantes, Université Paris sud 11, 91405 Orsay, France

References

<references> [1] [2] [3] [4] [5]

Structured Information

Gene Name

Os04g0271200

Description

Silent information regulator protein Sir2 family protein

Version

NM_001058879.1 GI:115457487 GeneID:4335343

Length

2712 bp

Definition

Oryza sativa Japonica Group Os04g0271200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:11382902..11385613

Sequence Coding Region

11382931..11383001,11383087..11383198,11383743..11383761,11384020..11384108,11384528..11384581
,11384732..11384802,11384906..11384987,11385087..11385183,11385304..11385374

Expression

GEO Profiles:Os04g0271200

Genome Context

<gbrowseImage1> name=NC_008397:11382902..11385613 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:11382902..11385613 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgggcgtcgggtcggcggtgcggcggctctacctctccgtttacaactgggccgtcttcttcggatgggcgcaggtgctgtactacgcggtcacgacgctgctggagagcggccatgaggccgtctacgccgccgtcgagcggccgctgcagttcgcgcagaccgccgccttcttggagattcttcatgggcttgtaggtttggtgaggtctccagtctctgcaactcttccacaaattggatcgaggttgtttcttacctggggcatcctgtggagctttccagagacacattcacatatccttgttacttccttggtcataagctggtccatcactgagatcattagatattccttctttggcatgaaggaggcattcggatttgctccttcctggctcttatggctgaggtatagcacctttatggtattgtatcctactggtatcagcagtgaggtcggtttaatctacattgccttgccttacatgaaggcatcagagaaatactgccttaggatgcccaacaaatggaacttctcctttgatttcttctatgcatccatcctttctctcgccatctacgtgcccggatcgcctcacatgttcacctacatgcttgcccaacggaagaaggcattggcaaaggctaaggctgcataa</cdnaseq>

Protein Sequence

<aaseq>MAGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVY AAVERPLQFAQTAAFLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHI LVTSLVISWSITEIIRYSFFGMKEAFGFAPSWLLWLRYSTFMVLYPTGISSEVGLIYI ALPYMKASEKYCLRMPNKWNFSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKA KAA</aaseq>

Gene Sequence

<dnaseqindica>30..100#186..297#842..860#1119..1207#1627..1680#1831..1901#2005..2086#2186..2282#2403..2473#ccttgttagctactgctgagtgctcggcgatggcgggcgtcgggtcggcggtgcggcggctctacctctccgtttacaactgggccgtcttcttcggatggtactctgccgcctcgcgccaccgcctgctggcgtttggatccttgttttcttggcttgatttgggggtttcttggatcttgcagggcgcaggtgctgtactacgcggtcacgacgctgctggagagcggccatgaggccgtctacgccgccgtcgagcggccgctgcagttcgcgcagaccgccgccttcttggaggtctggtttttctgctattctgtgcgctctgacttatttttgaattttaatcgcagtaaaactgtagattttagcgcaagcttgtataatttgggcagctctgacttaattttgaatttttcgtctacccaattagggttgctggtgttgagcaatggcacagaggaaaaaaatttatccccttttgcgttctaaaaatcaaccaaacatttagcctgagagaaatattaccagtgttatagcaaaatatactgcaattaattcaacttcaatgttattatgtttctgctgcctgatcctctcccccgataattctgctaaaaagaaaagaaaaatttctgctgccctatactttgtgttaaattccttgtagttccctggataaggaagcatttatattctttgcacggagcagctgaacgagtctgcggtgaacacagaatgaacgagtattccatgtttatttcatttctttgcaaattgtgttttgtgaggtactgaacatttttgtgtttgtttggcgatggcgttgctggtggctcagattcttcatgggcttgtaggtaagaagttgttcttctcttctacttatgttattttcactatccttgtcatcatttggaatcgtacggtttctgtctatagcgtgccgcttgcaaactgcatggaaatagactttcttgttagaaagcacgtcaaagacacatttcaatttacaggaagtgtcctgttagattatgaaaataattgtacttaataagttcacttttacggcactttcatttttttcacctgtataacatgctgactttgttttaaaggtttggtgaggtctccagtctctgcaactcttccacaaattggatcgaggttgtttcttacctggggcatcctgtggagctttccagaggtatcatcgactatcactaacaagtgttgatgtgctatgttcatgagatttggaaattttcttctttagttagacacttctcctaagcgcttactgtttctccgagacattgaaacatgacataattttggggtttaaaaccattgtctaaataggaaatatggattatatgatttgatttttatatgaggacaggacactaggtagtttgtctgttttatatctggttgtggatcaagtaaataatggtgatgattgtacaagttactaaatggcataactactggtactgatatgcaaatgcagtgcctttacttttgcatccctagttttctgttagttgcatacttgtagtgtagcttaacacctggtttcttgacatatatattgattgacccctttgtacatttgtcttgcagacacattcacatatccttgttacttccttggtcataagctggtccatcactgaggtatattttaaagacttgcttcttaaagagacactgtattttccaaattctaattttgatttttcctgtgctaagcttattcacaccaatatttaaaatattgtgaatttgatagcataacgtgatggaaatatttgtggttccttgcagatcattagatattccttctttggcatgaaggaggcattcggatttgctccttcctggctcttatggctgaggttagtaaagaagatatatcattatttaggacaaatttagagggaatgattttctttttctttcataactttttttcttaaacctggtgctgattttgtacaggtatagcacctttatggtattgtatcctactggtatcagcagtgaggtcggtttaatctacattgccttgccttacatgaaggtaacaagaatgaacttcagaaatgaagatctccacgttgttcattgcataatgcataatgcgtaatttaactgctcctttcttgtgactactatgcaggcatcagagaaatactgccttaggatgcccaacaaatggaacttctcctttgatttcttctatgcatccatcctttctctcgccatctacgtgcccggtatcccctcctgccttgcagtcatcctttattcagtggttgaaattaaaactagaattgcaatgttgttttttagtagctgggattaagataggatctgacaagaacactgcgttgcaggatcgcctcacatgttcacctacatgcttgcccaacggaagaaggcattggcaaaggctaaggctgcataatggtgatgctcaagagctttcttgaatttttcatgtgtggcttaaggatctgcctaaatagctcatatttgctactcttttagtacaagtctgtagatgaggaaatgttggaaagaactactatcttaatcccagcatttgttgtaactgtagtaactgcccatcatttgttgtaactgtagtcttctaccaagaattgtatgatattttacctggttaaattattgaatgattgatcc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0271200, RefSeq:Os04g0271200

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Huang, L., et al., Down-regulation of a SILENT INFORMATION REGULATOR2-related histone deacetylase gene, OsSRT1, induces DNA fragmentation and cell death in rice. Plant Physiol, 2007. 144(3): p. 1508-19.
  2. 2.0 2.1 2.2 2.3 Hu, Y., et al., Rice histone deacetylase genes display specific expression patterns and developmental functions. Biochem Biophys Res Commun, 2009. 388(2): p. 266-71.
  3. 3.0 3.1 3.2 3.3 3.4 3.5 Liu, X., et al., Transcriptional repression by histone deacetylases in plants. Mol Plant, 2014. 7(5): p. 764-72.
  4. 4.0 4.1 4.2 Konig, A.C., et al., The Arabidopsis Class II Sirtuin Is a Lysine Deacetylase and Interacts with Mitochondrial Energy Metabolism. Plant Physiology, 2014. 164(3): p. 1401-1414.
  5. 5.0 5.1 Pandey R, Muller A, Napoli CA, Selinger DA, Pikaard CS, Richards EJ, Bender J, Mount DW, Jorgensen RA (2002) Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes. Nucleic Acids Res 30: 5036–5055