Os02g0203500

From RiceWiki
Revision as of 16:27, 8 June 2014 by YinQi (talk | contribs) (Evolution)
Jump to: navigation, search

RLS1 encodes a previouslyuncharacterized NB (nucleotide-binding site)-containing protein with an ARM (armadillo) domain at the carboxyl terminus .[1]


Annotated Information

Function

1.Map-based cloning of the RLS1 gene revealed that it encodes a previously uncharacterized NB (nucleotide-binding site)-containing protein with an ARM (armadillo) domain at the carboxyl terminus.[1]

2.Consistent with its involvement in leaf senescence, RLS1 was up-regulated during dark-induced leaf senescence and down-regulated by cytokinin.[1]

3.Intriguingly, constitutive expression of RLS1 also slightly accelerated leaf senescence with decreased chlorophyll content in transgenic rice plants.[1]

4. the RLS1 gene might be involved in PCD that affects specific cellular processes.previously uncharacterized NB–ARM protein involved in PCD during plant growth and development, providing a unique tool for dissecting possible autophagymediated PCD during senescence in plants.[1]

5. RLS1 Is necessary for proper Chloroplast degradation.the mutation in the RLS1 accelerates the degradation of chloroplasts probably through an autophagy-mediated partial degradation process[1]

Expression

1.There is only one copy of the RLS1 gene in the rice genome. The RLS1 homolog genes with unknown function were only found in sorghum, grape, and black cottonwood by a BLAST search. The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood.[1] Genetic studies have provided evidence that NB-containing R proteins in plant, such as RPS4, RPM1, can activate cell death during HR execution (Hofius et al., 2009).[2]

2. RLS1 expression Is affected by dark-induced senescence and Cytokinin treatment.[1] RLS1 was more closely related to the CC-NB-LRR proteins, Rx, I2, R3a (Moffett et al., 2002[3]; Couch et al., 2006[4]; Jia et al., 2010)[5]the expression of RLS1 was significantly induced in the seedlings transferred into darkness and reached the maximum level 12 h after treatment (Figure1). Accumulation of the RLS1 transcript was markedly reduced in the seedlings treated with 20 lM trans-zeatin (tZ) for 24 h (Figure1). These results suggested that RLS1 is involved in leaf senescence.[1]
figure1 (from reference [1]).

3. The expression profile of RLS1 was investigated in various rice tissues at the adult stage with the quantitative real-time PCR approach. The results showed that RLS1 transcripts accumulated constitutively during leaf development, from young to senescent leaves (Figure 1). In addition, RLS1 was constitutively but weakly expressed in the root of seedling, panicle, and spikelet. The highest level of the RLS1 transcript was detected in mature leaves, consistent with the phenotype of rls1.[1]

4. Overexpression of RLS1 displays a weak Phenotype of accelerated leaf senescence(figure2)leaves of RLS1-overexpressing plants senesced more rapidly than did

wild-type leaves. Individual leaves from wild-type plants became pale green after 4 d of dark treatment, whereas leaves from the RLS1-overexpressing plants showed severe yellowing. This was consistent with chlorophyll content of detached leaves during dark treatment[1]
figure2 (from reference [1]).
figure2 (from reference [1]).

Evolution

1.The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood. Moreover, it is also similar (23–30% similarity) to those of various NB-containing R proteins (Figure 3A). We then assessed the sequence diversity of the selected homologs, by generating a phylogenetic tree using the NB sequences (Figure 3B)[1].
figure3A (from reference [1]).
figure3B (from reference [1]).

2.The RLS1 locus was roughly mapped on chromosome 2. Subsequent finingmapping delimited the RLS1 locus to a 60-kb region between markers M17 and M24 (Figure 4A

and 4B). DNA sequencing analysis of the entire region in the rls1 mutant revealed a single C-to-T nucleotide substitution in the second exon of LOC_Os02g10900 (MSU Rice Genome Annotation Project: http://rice.plantbiology.msu.edu/), which results in Ser-to-Phe change at 994 residue (Figure 4C).[1]

Labs working on this gene

1.National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China[1]

2.Zhejiang Academy of Agricultural Sciences, Hangzhou 310021, China[1]

3. China National Rice Research Institute, Hangzhou 310006, China[1]

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 Bin-Bin Jiao;Jian-Jun Wang;Xu-Dong Zhu;Long-Jun Zeng;Qun Li;Zu-Hua He . A Novel Protein RLS1 with NB–ARM Domains Is Involved in Chloroplast Degradation during Leaf Senescence in Rice Molecular Plant, 2012, 5(1): 205-217
  2. Hofius, D., Schultz-Larsen, T., Joensen, J., Tsitsigiannis, D.I., Petersen, N.H., Mattsson, O., Jorgensen, L.B., Jones, J.D., Mundy, J., and Petersen, M. (2009). Autophagic components contribute to hypersensitive cell death in Arabidopsis. Cell. 137, 773–783.
  3. Moffett, P., Farnham, G., Peart, J., and Baulcombe, D.C. (2002). Interaction between domains of a plant NBS–LRR protein in disease resistance-related cell death. EMBO J. 21, 4511–4519.
  4. Couch, B.C., Spangler, R., Ramos, C., and May, G. (2006). Pervasive purifying selection characterizes the evolution of I2 homologs. Mol. Plant–Microbe Interact. 19, 288–303.
  5. Jia, Z., Cui, Y., Li, Y.,Wang, X., Du, Y., and Huang, S. (2010). Inducible positive mutant screening system to unveil the signaling pathway of late blight resistance. J. Integr. Plant Biol. 52, 476–484.

Structured Information

Gene Name

Os02g0203500

Description

Disease resistance protein family protein

Version

NM_001052774.2 GI:297598786 GeneID:4328665

Length

3672 bp

Definition

Oryza sativa Japonica Group Os02g0203500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:5785295..5788966

Sequence Coding Region

5785295..5787370,5787723..5788797,5788881..5788966

Expression

GEO Profiles:Os02g0203500

Genome Context

<gbrowseImage1> name=NC_008395:5785295..5788966 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:5785295..5788966 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggttggtgatgtcgaggttgatgaaggaacgggaccggaggattcggtgttggagttggtggcggccaggagaacgcacgccattggtttgtttgaccggaagcgaggccatatggatgctgtgaatgttcttgcctcggcgacccagctggtgtccgcgatgctcaccgcggtcggcgcgctggagcaggcggctgccgacttcgccgaggctcccaggaggctccaggttcttgaggattttgtgtccgaccttgggctgttgatgcagcaatccaagcagaagcacgcgcacaagatgcacgcgccgcagctcgagcgtcagctccagagcctaggcaagctgatggaccagctccatgccaacatcacaaaggcgaggcgggtgttgaagaaaggcaaagggaagaagggcttggccagagttgtgtggagctcggtgacaggggaccctctgatgaagtatgttcagctgatcagggatgatctcaactggtggcttgagttacagaagctaacagagagtgtgggcaatgtcatagcgtctacagctaagagtacgccatccttggtgagagtcaagtcggagcatggctatccagtgtcaaagaagtgcagctatgtcagggagctgcttatcaatgatggtagtcatcgagttgtcctgattgtcgggttatctggtattgggaagtcgtgtcttgctcgacaaatagcttctgacccgcctggtaattttgtggatggtgcaattgagcttagttttgggcggtggtgcagtagagcggcatgcaatggtaatagggatgaataccacaagcgtcttgttcggaaaatatgtaaatttcttgtgcagattggttccatgactgtcaatgaggatgtgggcaaagatcttgaagatgtctgttacttgcttcagactgcattggtaggaaggagcatgctgatcctacttgatgatgtctgggagcaagacatagttgatcgcttcacaaacctatatgataatgattgccggtatcttgtgacaacgagggatgaggcaatttatgagattgcagaagctgaaaaggtggaaatatccaaagatgatatcaaagaaattggcaaggacattcttctctatcatagccttcttactgttgaagagctcccgcctgttgcgtacgacttgctggatcgttgcggccaccatccccttacagttgctgtcatgggtaaggctctcagaaaggagaccagagtcgaaaaatgggatagagcaatctccaacctttccacatatgcaacttgtgcacctggaccggtttcatatgtgaatgagaaagaagtggaaaccacattgaccatctttgggtcttttgagttcagcttagaagcaatgccagaaaattcaagaaggtttttcatggtgcttgcagctatctcatgggatgaacctgttccagaggcttgccttgaatccatgtggtcagcactcatgcaggacactttattccccctcgtggtctcgaaactagtagaaggctcactcattatcaaactggaagaccaatcgatgtatcatatgcatgacatggtttcgctttacctcgagagtaaaacagacaacgctgttcatactcttttgttcggttcatttcctgaatatgctgcattggtgtctccttggcttttcatttttggcaaagagagcgcaaaagagcgagctgaacagaagataagatcattattttctttgctagagttcatggagatagagattttactaggaagcaccacccaagctctcatggaatgcaaatccatatctgaatttgaggctagcaggcttcacttcagcaaaatacttagtcctcgaatagcggagttaatttctgtggggtcaacatctctcattgttactgtcaccaaatctattacagtaatctttttccaaggagattatgctaagcttgctcagtctcttgaaacagcaggttctgtggataaattaattcatgttcttcgtggctgtgaagattcttctactctagccaatgtttctactgttcttgccaagatatctgagcatgttgatgctacaactgctgatgaaattttggcaaccattcctatggaccaaattgcgaaattactctctcctgagaatgaagaatggcatgaaattgtgtttacaactctagcatctttgataaaggtgggaaagttaagggctgttgagacaatgatcgaatcaggaattgacaagaagcttcttgttcttctaggcagtggttctgagatctcacagcatcatgcgattatcatgctaaaaacattctgtgaacttggtgcgccacttcaggggtgcatgggacctggagcgttgactcatttgccttggcatgctcgtctcagtttggagagatttgttttatttgaccaaaatgtaactccatcaccaaagcctcaacaatcttttgagttgattcttcacaagatactgcacagagacaacaaagataacattgaggcgatccaaggtttattacctctcgctgagagggctaatgattcaagggtgcaagatctccttttgggaagcaatatgtccaatgggttggcactgctgctgcaacggagagacattgaaagcaaccaagtgaggtctcacactgcttttctggtgatgaaattagcctgcactggaggggaaccatatgtccataggttcttagaggctaacattgttcatgagctaattgacatgatgcagtgcaacatcaacgatctccaggattcagcatactatgcccttcaccagattatctttgcgaaggggggatcacttgtattacagagatttttacaagcaggaaccattgaaaaattggttaacttgcttgaccgcaagtcttcaaagacaaaggaactaacaatgcagcttctggtagacattgcggtggtcggaaccaaaccttgcatcgaaagaatgctctcgtcccaaatcatcgagaaatttgtggcactcgagaaagcaggtgggtctttcagtggagcggtatcaagatacgtgcaggggttgaacatgtgcaagaacgtccagtctgctgagagatcagtcatgaagcaacagattctgaggaaagtgagatcagagataagaggtcatgatctggaagcaagtctagttgcctctgtggaagcttgcatttctgaaaaaggagccagcagcaggaggaaaaagtag</cdnaseq>

Protein Sequence

<aaseq>MVGDVEVDEGTGPEDSVLELVAARRTHAIGLFDRKRGHMDAVNV LASATQLVSAMLTAVGALEQAAADFAEAPRRLQVLEDFVSDLGLLMQQSKQKHAHKMH APQLERQLQSLGKLMDQLHANITKARRVLKKGKGKKGLARVVWSSVTGDPLMKYVQLI RDDLNWWLELQKLTESVGNVIASTAKSTPSLVRVKSEHGYPVSKKCSYVRELLINDGS HRVVLIVGLSGIGKSCLARQIASDPPGNFVDGAIELSFGRWCSRAACNGNRDEYHKRL VRKICKFLVQIGSMTVNEDVGKDLEDVCYLLQTALVGRSMLILLDDVWEQDIVDRFTN LYDNDCRYLVTTRDEAIYEIAEAEKVEISKDDIKEIGKDILLYHSLLTVEELPPVAYD LLDRCGHHPLTVAVMGKALRKETRVEKWDRAISNLSTYATCAPGPVSYVNEKEVETTL TIFGSFEFSLEAMPENSRRFFMVLAAISWDEPVPEACLESMWSALMQDTLFPLVVSKL VEGSLIIKLEDQSMYHMHDMVSLYLESKTDNAVHTLLFGSFPEYAALVSPWLFIFGKE SAKERAEQKIRSLFSLLEFMEIEILLGSTTQALMECKSISEFEASRLHFSKILSPRIA ELISVGSTSLIVTVTKSITVIFFQGDYAKLAQSLETAGSVDKLIHVLRGCEDSSTLAN VSTVLAKISEHVDATTADEILATIPMDQIAKLLSPENEEWHEIVFTTLASLIKVGKLR AVETMIESGIDKKLLVLLGSGSEISQHHAIIMLKTFCELGAPLQGCMGPGALTHLPWH ARLSLERFVLFDQNVTPSPKPQQSFELILHKILHRDNKDNIEAIQGLLPLAERANDSR VQDLLLGSNMSNGLALLLQRRDIESNQVRSHTAFLVMKLACTGGEPYVHRFLEANIVH ELIDMMQCNINDLQDSAYYALHQIIFAKGGSLVLQRFLQAGTIEKLVNLLDRKSSKTK ELTMQLLVDIAVVGTKPCIERMLSSQIIEKFVALEKAGGSFSGAVSRYVQGLNMCKNV QSAERSVMKQQILRKVRSEIRGHDLEASLVASVEACISEKGASSRRKK</aaseq>

Gene Sequence

<dnaseqindica>1597..3672#170..1244#1..86#atggttggtgatgtcgaggttgatgaaggaacgggaccggaggattcggtgttggagttggtggcggccaggagaacgcacgccatgtgttcgtcggattgtcgcagccagctctgagtattgaattcttgctaggggagagattggagcttcgttgctgttgctctagtggtttgtttgaccggaagcgaggccatatggatgctgtgaatgttcttgcctcggcgacccagctggtgtccgcgatgctcaccgcggtcggcgcgctggagcaggcggctgccgacttcgccgaggctcccaggaggctccaggttcttgaggattttgtgtccgaccttgggctgttgatgcagcaatccaagcagaagcacgcgcacaagatgcacgcgccgcagctcgagcgtcagctccagagcctaggcaagctgatggaccagctccatgccaacatcacaaaggcgaggcgggtgttgaagaaaggcaaagggaagaagggcttggccagagttgtgtggagctcggtgacaggggaccctctgatgaagtatgttcagctgatcagggatgatctcaactggtggcttgagttacagaagctaacagagagtgtgggcaatgtcatagcgtctacagctaagagtacgccatccttggtgagagtcaagtcggagcatggctatccagtgtcaaagaagtgcagctatgtcagggagctgcttatcaatgatggtagtcatcgagttgtcctgattgtcgggttatctggtattgggaagtcgtgtcttgctcgacaaatagcttctgacccgcctggtaattttgtggatggtgcaattgagcttagttttgggcggtggtgcagtagagcggcatgcaatggtaatagggatgaataccacaagcgtcttgttcggaaaatatgtaaatttcttgtgcagattggttccatgactgtcaatgaggatgtgggcaaagatcttgaagatgtctgttacttgcttcagactgcattggtaggaaggagcatgctgatcctacttgatgatgtctgggagcaagacatagttgatcgcttcacaaacctatatgataatgattgccggtatcttgtgacaacgagggatgaggcaatttatgagattgcagaagctgaaaaggtggaaatatccaaagatgatatcaaagaaattggcaaggacattcttctctatcatagccttcttactgttgaagagctcccggtatactcttctatttgcatctttcatggttactgaatactcctgcactttagcctattttagttttacctgataaaattgttttgcaccctgcagctaaggtatcatcttcatgtggattgtatatgtgtttacatttcaacattggtttcgttttaatatccttcatgtttaacatggaaagtacacaaatatagttagccaactatttatattcatgttagtctacttaaagtaattagttatatgtgtatctgtcatacaagagatgttcaatatgtaacttagaacttagaactactaaagacctagttttatgggtttgtatggttaacattcctgttctttacagcctgttgcgtacgacttgctggatcgttgcggccaccatccccttacagttgctgtcatgggtaaggctctcagaaaggagaccagagtcgaaaaatgggatagagcaatctccaacctttccacatatgcaacttgtgcacctggaccggtttcatatgtgaatgagaaagaagtggaaaccacattgaccatctttgggtcttttgagttcagcttagaagcaatgccagaaaattcaagaaggtttttcatggtgcttgcagctatctcatgggatgaacctgttccagaggcttgccttgaatccatgtggtcagcactcatgcaggacactttattccccctcgtggtctcgaaactagtagaaggctcactcattatcaaactggaagaccaatcgatgtatcatatgcatgacatggtttcgctttacctcgagagtaaaacagacaacgctgttcatactcttttgttcggttcatttcctgaatatgctgcattggtgtctccttggcttttcatttttggcaaagagagcgcaaaagagcgagctgaacagaagataagatcattattttctttgctagagttcatggagatagagattttactaggaagcaccacccaagctctcatggaatgcaaatccatatctgaatttgaggctagcaggcttcacttcagcaaaatacttagtcctcgaatagcggagttaatttctgtggggtcaacatctctcattgttactgtcaccaaatctattacagtaatctttttccaaggagattatgctaagcttgctcagtctcttgaaacagcaggttctgtggataaattaattcatgttcttcgtggctgtgaagattcttctactctagccaatgtttctactgttcttgccaagatatctgagcatgttgatgctacaactgctgatgaaattttggcaaccattcctatggaccaaattgcgaaattactctctcctgagaatgaagaatggcatgaaattgtgtttacaactctagcatctttgataaaggtgggaaagttaagggctgttgagacaatgatcgaatcaggaattgacaagaagcttcttgttcttctaggcagtggttctgagatctcacagcatcatgcgattatcatgctaaaaacattctgtgaacttggtgcgccacttcaggggtgcatgggacctggagcgttgactcatttgccttggcatgctcgtctcagtttggagagatttgttttatttgaccaaaatgtaactccatcaccaaagcctcaacaatcttttgagttgattcttcacaagatactgcacagagacaacaaagataacattgaggcgatccaaggtttattacctctcgctgagagggctaatgattcaagggtgcaagatctccttttgggaagcaatatgtccaatgggttggcactgctgctgcaacggagagacattgaaagcaaccaagtgaggtctcacactgcttttctggtgatgaaattagcctgcactggaggggaaccatatgtccataggttcttagaggctaacattgttcatgagctaattgacatgatgcagtgcaacatcaacgatctccaggattcagcatactatgcccttcaccagattatctttgcgaaggggggatcacttgtattacagagatttttacaagcaggaaccattgaaaaattggttaacttgcttgaccgcaagtcttcaaagacaaaggaactaacaatgcagcttctggtagacattgcggtggtcggaaccaaaccttgcatcgaaagaatgctctcgtcccaaatcatcgagaaatttgtggcactcgagaaagcaggtgggtctttcagtggagcggtatcaagatacgtgcaggggttgaacatgtgcaagaacgtccagtctgctgagagatcagtcatgaagcaacagattctgaggaaagtgagatcagagataagaggtcatgatctggaagcaagtctagttgcctctgtggaagcttgcatttctgaaaaaggagccagcagcaggaggaaaaagtag</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0203500, RefSeq:Os02g0203500