Os06g0603000
Please input one-sentence summary here.
Contents
Annotated Information
Photoperiod-sensitive gene PHOTOPERIOD SENSITIVITY5 (SE5) encoding a heme oxygenase gene,is involved in phytochrome chromophore biosynthesis. It affects Rice's heading and maturity,and it's photoperiod sensitive. Short-day rice can promote early flowering.The photoperiodic sensitivity 5 (se5) mutant of rice, a short-day plant, has a very early flowering phenotype and is completely deficient in photoperiodic response.
Function
PHOTOPERIOD SENSITIVITY 5 ( SE5 ) was first presumed to encode a rice HO with high similarity to Arabidopsis HY1, although enzyme activity of SE5 was not confirmed (Izawa et al. 2000). The se5 mutant has a very early flowering phenotype under both short-day and long-day (LD) conditions, and is completely deficient in photoperiodic response (Izawa et al. 2000).Previous pharmacological results have shown that hematin, an HO-1 inducer, could protect wheat leaves from oxidative damage triggered by paraquat and Peroxide (Sa et al. 2007).In the present study,they showed that the SE5 protein was located in the chloroplast at least, and exhibited HO activity. Subsequently, RNAi knockdown of the rice SE5 gene results in loss of SE5 mRNA and SE5 protein. We also demonstrated that com-pared with wild-type, SE5 RNAi plants were more sus-ceptible to MV treatment. As expected in a se5 mutant (Izawa et al. 2000), there was a similar phenotype of early flowering under LD conditions. By contrast, the addition of exogenous CO aqueous solution partially rescued the cor-responding MV hypersensitivity. Transgenic Arabidopsis plants overexpressing SE5 and HY1 were generated and their corresponding tolerance phenotypes in the presence of MV were characterized.
Location and Expression
SE5 was localized to the chloroplast An 870-bp full length cDNA of SE5 was amplified by RT-PCR from rice seedling leaves. The coding region of SE5 encodes 289 amino acids with a calculated molecular weight of 31.9 kDa. This includes a 64-amino-acid transit peptide identified by the ChloroP algorithm (Emanuelsson et al. 1999; http://www.cbs.dtu.dk/services/ChloroP/), suggesting a mature SE5 protein (mSE5; i.e. without the predicted transit peptide) of 25.6 kDa. To verify the subcellular localization of SE5, we constructed a vector that constitutively expressed SE5–GFP fusion protein using the CaMV 35S promoter. Then, the resulting construct and GFP control plasmid were transformed into Arabidopsis protoplasts, and the fluorescent signals were observed by a confocal laser scanning microscope. The green fluorescent signal of SE5-GFP fusion protein co-localized with the auto-fluorescence of chlorophylls in chloroplasts (Fig. 1), demonstrating that the fusion protein was efficiently targeted to chloroplasts. By contrast, the protoplast transformed with the empty GFP vector alone has green fluorescent signals in the cytosol and nucleus (Fig. 1). Additionally, non-transformed protoplast (control) for auto-fluorescence with the same acquisition parameters was shown. Fig. 1 Subcellular localization of SE5 protein. SE5-GFP fusion protein or GFP alone expressed under the control of CaMV 35S promoter in Arabidopsis protoplasts was observed under a confocal microscope. Additionally, non-transformed protoplasts for auto-fluorescence with the same acquisition parameters were shown. The photographs were taken in the blue channel (left), in the red channel (middle), and in their combination (right). Scale bars represent 10 μm To confirm that SE5 encodes a HO and to further characterize its properties, the recombinant His-tagged mSE5 protein was induced by IPTG. The recombinant protein was expressed as a soluble protein of 29.1 kDa, approximately corresponding to the molecular weight of the mSE5 protein (25.6 kDa) plus that of 6 × His-tag (0.7 kDa) and the translated vector sequence (2.6 kDa). After purification by Ni-affinity chromatography, it yielded a single band (Fig. 2a, lane 1), which was recognized by the polyclonal antiserum against mSE5 (Fig. 2a, lane 2).
Fig. 2 Expression and biochemical characterization of purified recombinant His-tagged mature SE5 (mSE5) protein in E. coli. a Expressed protein purified by Ni-affinity chromatography and its western blotting analysis, 30 μg protein/well. Lane M, marker proteins; lane 1, purified protein; lane 2, western blotting analysis of purified protein developed with the polyclonal antiserum against the mSE5. Arrow indicates the position of the fusion protein of mSE5 with a molecular mass of 29.1 kDa. b Time-course of absorbance changes were determined during the mSE5 reaction with spectra taken at 0, 1, 2, 5, 10 and 20 min after the addition of NADPH. Arrows indicate the direction of the major changes in absorption during the course of the measurements. c Michaelis–Menten plot of the mSE5 reaction for hemin concentrations of 0.5, 2, 5, 10 and 20 μM. Inset: Lineweaver–Burk plot of the same data. Data shown are the mean ± SE from three independent measurements. d pH (left) and temperature (right) dependence of the mSE5 reaction. The relative activity of mSE5 was calculated by BV formation In a subsequent test, they measured the HO activity of mSE5 by spectrophotometrically examining the conversion of heme to BV (Fig. 2b)[1]. Absorbance was monitored between 350 and 800 nm, with bound-heme showing strong absorbance at 405 nm and BV at 665 nm. Over a period of 20 min of incubation, the bound-heme peak decreased substantially, accompanied by a concomitant rise in the BV absorbance maxima (Fig. 2b). The reaction rate for the formation of BV was also determined by monitoring absorbance at 665 nm (Fig. 2c). Using the above data, we determined the kinetic constants for the HO reaction from a Lineweaver–Burk plot (Fig. 2c, insert). Under our experimental conditions, the V max value for the complete reaction was estimated as 62.5 nmol BV h−1 mg protein−1 with an apparent K m value for hemin of 2.9 μM. Furthermore, the rate of the mSE5 reaction increased to a peak value at pH 7.0 and declined thereafter (Fig. 2d, left). In contrast, mSE5 enzyme activity increased with rising temperature within 10–50 °C (Fig. 2d, right), comparable to values obtained from Arabidopsis HY1 (Muramoto et al. 2002, Gisk et al. 2010).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.College of Life Sciences, Cooperative Demonstration Laboratory of Centrifuge Technique, Nanjing Agricultural University, Nanjing, 210095, People’s Republic of China
2. Beckman Coulter Ltd. Co., Nanjing Agricultural University, Nanjing, 210095, People’s Republic of China
3. Jiangsu Province Key Laboratory for Plant Ex-situ Conservation, Institute of Botany, Jiangsu Province and the Chinese Academy of Sciences, Nanjing, 210014, People’s Republic of China
4. Institute of Food Crops, Jiangsu Academy of Agricultural Sciences, Nanjing, 210014, People’s Republic of China
5. Key Laboratory of Protection and Development Utilization of Tropical Crop Germplasm Resources, College of Horticulture and Landscape Architecture, Hainan University, Haikou, 570228, People’s Republic of China
6.Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, Takayama, Ikoma, Nara 630-0101, Japan
7.National Institute of Agrobiological Resources, Kannondai, Tsukuba, Ibaraki 305-8602, Japan
8.Research Institute for Advanced Science and Technology, University of Osaka Prefecture, Sakai, Osaka 599-8570, Japan
References
<references> [1]
Structured Information
| Gene Name |
Os06g0603000 |
|---|---|
| Description |
Similar to Heme oxygenase 1 (Fragment) |
| Version |
NM_001064546.1 GI:115468823 GeneID:4341462 |
| Length |
4245 bp |
| Definition |
Oryza sativa Japonica Group Os06g0603000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24730775..24735019 |
| Sequence Coding Region |
24730947..24731039,24731154..24731261,24731800..24732023,24734283..24734727 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24730775..24735019 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24730775..24735019 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcccgcggcagcgtcgctcacggcccccaacgcactcgcggcgacgtcgttgcccttcttgcacggaaggaagagcggcggcggcggcgtgtccgtgcacgccggggcgccttcgccttcgcgggcggtggcggtggtggcgcggaggttgtgggggagcgctagcagtagcaggaggatggtggtggcggcggcgacggcggcggagatggcgcccgcggcgagcggggaggaagggaagccgttcgtggaggagatgagggcggtggccatgcggctgcacaccaaggaccaggccaaggaaggggagaaggagccgcaggcgccgccggtggccaggtgggagccctccgtggacggctacctccgcttcctcgtcgacagcaagctcgtcttcgagacgctcgagaccatcgtcgaccgcgccgccgtcccctggtatgctgagttcaggaatactgggttggagagatcagaacaactgaagaaggatctggaatggttcaaggaacagggtcacacaattccagaaccatctgctcccggcactacatatgcttcctatctggaagagctggctgaaaaggactcccaagcttttatctgccatttctataatgtgtattttgctcatacggctggaggccgaatgattgggaagaaggtctctgagaatattctgaacaagaaggagctggagttctacaaatgggagggcaatctgtcccagctgctgcagaatgtccgcaacaagcttaacgaagtcgcctctagctggacccgggaggagaaggaccattgcctggatgaaacggagaagtcgttctcgtattctggagatctcctccgtcacatattcacctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAPAAASLTAPNALAATSLPFLHGRKSGGGGVSVHAGAPSPSRA VAVVARRLWGSASSSRRMVVAAATAAEMAPAASGEEGKPFVEEMRAVAMRLHTKDQAK EGEKEPQAPPVARWEPSVDGYLRFLVDSKLVFETLETIVDRAAVPWYAEFRNTGLERS EQLKKDLEWFKEQGHTIPEPSAPGTTYASYLEELAEKDSQAFICHFYNVYFAHTAGGR MIGKKVSENILNKKELEFYKWEGNLSQLLQNVRNKLNEVASSWTREEKDHCLDETEKS FSYSGDLLRHIFT</aaseq> |
| Gene Sequence |
<dnaseqindica>3981..4073#3759..3866#2997..3220#293..737#attcccggccattccaatccactcccaccaccaagcgcgagctcgattatttttttaatcgattttctccgatttaatccgtagaaaattccccactcctcctcctcctccaccgccgccgccgacgccgcactcctcactccgcagaagcaacaccaacgccgcactccaacgccaaccgcctccgcgcgcggcccgtcgccatcgtcgagcaccttcacgcttcctcctcccccgcacggaacggagacccctagcgccgctataagagggagagaggtgggcgggactcatggcgcccgcggcagcgtcgctcacggcccccaacgcactcgcggcgacgtcgttgcccttcttgcacggaaggaagagcggcggcggcggcgtgtccgtgcacgccggggcgccttcgccttcgcgggcggtggcggtggtggcgcggaggttgtgggggagcgctagcagtagcaggaggatggtggtggcggcggcgacggcggcggagatggcgcccgcggcgagcggggaggaagggaagccgttcgtggaggagatgagggcggtggccatgcggctgcacaccaaggaccaggccaaggaaggggagaaggagccgcaggcgccgccggtggccaggtgggagccctccgtggacggctacctccgcttcctcgtcgacagcaagctcgtcttcgagacgctcgagaccatcgtcgaccgcgccgccgtcccctggtgtgagtgatcggaaaagctcttcctcctccgtgctctactttggaccgcttggaatttttgtggatgacgtttttttttagaaaattttgaactgaaatgatatttgattggttcatacggcgacacccatgaaagttggaaatatttctcaccttctgttctagaatagtcaaatagtataattgtttagccagaaaaaaattggatgcacagctttttgtgaaggaaaatgtcaaattgaagttggatgtgccatatggtgggagtaggagcacttgcaaaccccctgttttgagtttggtttggatgcttgagaaaatatatgtaatccaagttaaggtattaaaagactttgagcctatgattatttcatgtcatcgaggaaattgcatcagctttggataagtcagctaccgatctgaaatttaaataaaaaaaatgtatatttccccttctgttacatgatatgctcttccactgaccataagaccagtgccatgtgcaggtggatccaatttaagtaacattcagcccacattttttaaaataaaacaaaggcatttctttgtcattgagaggcatccttgcctggcatgctgctagcaaaacatttggcaggcacagaatatgtttttgggagggtcttgataaaattgtttaggtgtttcgaaagtgttaaaacgctttactggcaacatttctttaagagtatcatcaaaatatcaatgtttgcctatatgtatcaagtaagaagtacaggaagccatgtgcatgtctatttgcagttggttggcacttggcggtataatcatctaaagtagtaccttactattggttcctattctatgggcaaacttgtatcgaccttctcgagagacatcctatattcctattcatggatgccttaaatcactaaaattttcattgtggctccctctgctgtttagaggtggcatccccagcacagttattttctgtatccacactcctgtattgcttcccttaatcatgtataagtcttgtattttggcattgtattgtttcgacacttggaattagaaatccttatattacattaccacttggcatgctatgtgcagaattacctcggtaggtttgtacttgcaaacagcttatgttggcaccatggtaccccaattttacatactcttgttctgttattctgctatggtctggtatgcaaataacacaataaacgttgcctccaattttggggggtgcacatcatgcagttattctgctagttgagttatgggcagcattttctttataacaggatttcttttgaaggaaatccttgagtctttataacagaatctttctggaatccgccttgtccttaacccttgagtctttgttacaccctttcatggacctacgttgtccgtcaatttgcctccactagctctctgtgtattggatggttggatgtgagaagcctctttcttattgatgattactttgcattttgcaaggaaaacatttcactagcaaagaaaattaaataatatataatgttaacaatgataccctttatatcttctagcttgcttgctgaagttttatggtatctggattgtctgcatttatctgtattggtgaaactctagatttttctatttgttttacatttgagttttagaacaacacgtagcttcgtgtttggctagttgaccagttccacttaagtacttctccgtttcatattatagtcgttttgattttgttgtagtcgaactttttaaaatttgaccaaatttgtagaaaaaatatagcaacatattcgacacaaaacaaacatattatccaaatatattaaatgttagttttaatgaaactaatttgatgttgtagatgttgctaaatttttctataaacttcatcaaacttctttaagtttgactaggaaaaaatcaaaacgacttataatatgaaatggagggattagtaaataattgagaagcaaataatgagtacctttattctactcctacataataccgtgtgcaatttgtttgcacctgaaatcttagcaggatagagaacttttgtagttttgtttatgctgtatggaagtatggaacaatgagtcataattacttgaacgtccacataaaatctgtaatattctttttagatggaaaattgaaactactataaaacagctagaagatttcttccatcaatatttgcaagaggctgcttattgacttcctatttatctgtatgtatttcagatgctgagttcaggaatactgggttggagagatcagaacaactgaagaaggatctggaatggttcaaggaacagggtcacacaattccagaaccatctgctcccggcactacatatgcttcctatctggaagagctggctgaaaaggactcccaagcttttatctgccatttctataatgtgtattttgctcatacggctggaggccgaatgattgggaagaaggtacagtttctgtcttttttaatgatgaattttttatatcattcaaaagctcactatcttttggtaacatagttcagaatggattcctataaatgcgtagaatattagctatcgaagcaacaaaactgacactaacagaaagtttgttctttgcttcattgcgctttcctgactgtatagtgtggacacttttgatgtgagatggtttcttttcttaggaatcagattgaccggttgctttggatgcttatattggtattttgttctaacaaaattatagagtacgctagtcgagataatgaaaatactacataaggcagcgagtgctttggcacgcagtcccttttaggatcctcttgccactactgttctcaagttgtgctgctcatagacgtcaaggtttttcaacccacctgacattattacaatgcggttttgtttgggcatatgaatagcagttttccatgcttgccacctcatttggttcaacttgtttgaatttcttaaacgtttaatcatgcccttgttatcatcttaggtctctgagaatattctgaacaagaaggagctggagttctacaaatgggagggcaatctgtcccagctgctgcagaatgtccgcaacaagcttaacgaagtcgcctctgtaagtccaggagctctatttgccacgccactatctcccccaattctttgatacgagcagtttgaaatgttgctaataaccaagctttaattgttccatttgctggccttgcagagctggacccgggaggagaaggaccattgcctggatgaaacggagaagtcgttctcgtattctggagatctcctccgtcacatattcacctaagcttaattgatcacggtgtctgctatctagtcttgataaacgctgtaaatactaaagttcacgtcagtcagacagactgttactggacactgggcagaggtcatttacttactcaaccagttggccttgcctcccatcaaattgccaaattctaataatccttcggtgtgcc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1. Sheng Xu;Lijuan Wang;Bo Zhang;Bin Han;Yanjie Xie;Jie Yang;Weigong Zhong;Huiping Chen;Ren Wang;Ning Wang;et al. RNAi knockdown of rice SE5 gene is sensitive to the herbicide methyl viologen by the down-regulation of antioxidant defense. Plant Molecular Biology, 2012, 80(2): 219-235
- ↑ 2. Izawa T; Oikawa T; Tokutomi S; Okuno K; Shimamoto K .Phytochromes confer the photoperiodic control of flowering in rice (a short-day plant).The Plant Journal, 2000, 22(5): 391-399
- ↑ 3. Masao YOKOO and Kazutoshi OKUNO.Genetic Analysis of Earliness Mutations Induced in the Rice Cultivar Norin 8. Japanese Journal of Breeding, 1993, 43(1): 1-11