Os06g0127100

From RiceWiki
Revision as of 01:09, 10 June 2014 by Aska (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Conserved amino acid residues and phylogeny construction using the AP2/ERF conserved domain sequence suggest that in rice the OsAP2/EREBP gene family can be classified broadly into four subfamilies [AP2, RAV (related to ABI3/VP1), DREB(dehydration-responsive element-binding protein) and ERF (ethylene-responsive factor)](Akhter Most Sharoni, 2010).The chromosomal localizations of the OsAP2/EREBP genes indicated 20 segmental duplication events involving 40 genes; 58 redundant OsAP2/EREBP genes were involved in tandem duplication events(Akhter Most Sharoni, 2010). Os06g0127100 comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes(Zhang, 2012).

Expression

In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response(Muhammad rashid, 2012). Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7).

Fig1.Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7). (from reference [1]).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

(A) Evolutionary relationships among rice AP2/EREBP domain sequences. The unrooted tree was generated by the Neighbor–Joiningmethod with the ClustalX program. Domains a and b were found in subfamilies RAV and AP2, e.g. in Os01g59780a and Os01g59780b, respectively.The RAV subfamily showed motif duplication, and the AP2 subfamily showed domain duplication. (B) Structure of AP2/EREBP genes (from reference [1]).

Labs working on this gene

Please input related labs here.

Conceived and designed the experiments: BF DY. Performed the experiments: TZ XZ WW YP LH XL LZ. Analyzed the data: TZ BF. Contributed reagents/materials/analysis tools: LZ YZ. Wrote the paper:BF TZ DY.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0127100

Description

Similar to CBF-like protein

Version

NM_001063196.1 GI:115466123 GeneID:4339974

Length

764 bp

Definition

Oryza sativa Japonica Group Os06g0127100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:1433771..1434534

Sequence Coding Region

1433798..1434442

Expression

GEO Profiles:Os06g0127100

Genome Context

<gbrowseImage1> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq>

Protein Sequence

<aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq>

Gene Sequence

<dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0127100, RefSeq:Os06g0127100

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named Akhter_Most_Sharoni