Os01g0859300

From RiceWiki
Revision as of 01:05, 24 December 2014 by Zhangye (talk | contribs) (Function)
Jump to: navigation, search

As a bZIP transcription factor,OsABI5 could regulate the adaptive stress response and plant fertility of rice[1][2].

Annotated Information

Function

OsABI5 could prevent growth in a stressed environment. It plays a important role during plant development, especially in the regulation of plant fertility. It is associated with the ABA signaling pathway and stress tolerance. OsABI5 is possibly involved in the formation of microspores and the regulation of plant fertility[1]. Two OsABI5 splicing variants were identified, designated OsABI5-1, and OsABI5-2 and their different expression patterns in tissues were analyzed. OsABI5 variants may have overlapping and distinct functions to fine tune gene expression in ABA signaling as transcription factors together with OsVP1 [2].

Mutation

Expression

Please input expression information here.

Subcellular localization

Evolution

Please input evolution information here.


Knowledge Extension

Labs working on this gene

Key Laboratory of Molecular and Developmental Biology, National Centre for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, P.O. Box 2707, South 1-3, Zhongguancun, Beijing 100080, P.R. China

References

<references>

</ref>

<references>

Structured Information

Gene Name

Os01g0859300

Description

Similar to ABA response element binding factor (Fragment)

Version

NM_001051401.1 GI:115441172 GeneID:4325061

Length

1601 bp

Definition

Oryza sativa Japonica Group Os01g0859300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:38930631..38932231

Sequence Coding Region

38930632..38931408,38931497..38931568,38931692..38931721,38931864..38931956

Expression

GEO Profiles:Os01g0859300

Genome Context

<gbrowseImage1> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:38930631..38932231 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagagaagacggttctactgacaaagaagcaaatgctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtga</cdnaseq>

Protein Sequence

<aaseq>SMNMDEFVANIWNAEEFQATTGGCKGAMEEAKVVDSGSGSGDAG GSGLCRQGSFSLPLPLCQKTVEEVWTEINQAPAHTSAPASALQPHAGSGGVAANDRQV TLGEMTLEDFLVKAGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGGPMMFPVGPVNAMY PVMGDGMGYPGGYNGMAIVPPPPPAQGAMVVVSPGSSDGMSAMTHADMMNCIGNGMMI ENGTRKRPHREDGCAEKTVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQEN ARLKEAEKTVLLTKKQMLVEKMMEQSKEKMNANRGGSQLRRSGSCMW</aaseq>

Gene Sequence

<dnaseqindica>2..778#867..938#1062..1091#1234..1326#ttccatgaacatggacgagtttgtggctaacatatggaatgctgaagaattccaggctaccaccggaggttgcaagggtgccatggaggaagccaaggtggtagacagtggaagcggaagcggtgatgcaggaggaagcggtttatgtcggcagggatcattttccttgccgctaccgctgtgccagaagacggtggaggaggtgtggactgagatcaaccaagcccctgcacacacctccgctccggcctccgcgctccagccacatgccgggagcggtggtgttgcagctaacgaccgacaggtaacactaggtgagatgacacttgaggatttcttggtaaaggccggggtggtccgagggtcctttaccgggcaagcggccatgggatctggcatggtcaacgggccggtgaaccccatgcagcagggccaaggcggtcctatgatgttcccagtaggaccggtaaacgccatgtatccggtgatgggtgatggcatggggtaccccggtgggtacaacgggatggcgattgtgccaccgccacctcccgcccaaggtgccatggttgtcgtgagtcctggatcatcagatgggatgagtgccatgacacatgctgatatgatgaattgtattgggaatgggatgatgattgagaatggaacaagaaagcgtccccacagagaggatggctgcgccgagaagacggtggagcgccgccaacggcgcatgatcaagaaccgtgagtcagctgcacggtcccgtgctagaaagcaggtacacatgttgctccgaaccttttagtttctatgtatcgttaagacattttgcatggagattgaaatttttatgaataatgctacaggcttatacggtggagctcgaagctgaactgaactatctcaagcaggagaacgctcgtctcaaagaggcagaggtattaaagcaagaaacattatccactcagctttcattgtcattcctaaacagtctcgttccttccttttctgtaacattgaactgataaatatacaatgtctatattatcttccttttacagaagacggttctactgacaaagaagcaaatggtattgtcctctcccatgtggcaatccccattccgcatagtgctcatcgttttgtgaaattattaaatacatatttgttattcatttatttgtgtgtgtatatatgctcatggaaatatgtcgtgttcctgtgatttttcagctggttgagaaaatgatggagcagtccaaggagaagatgaatgcaaataggggtggcagccagctgcgccgcagcggcagctgcatgtggtgaaacgggcatagcggtgaccggcgagtggcacactcatcctgcttctggtgtggcactagcctctgaggctctgaagaggatttgcacattaagtcttctttcagactaagtgatgtgaaggtattatggtagtagttgatatacatatatgctgtgatgcttgtaaacctgcctggacccacatgtcttgccatcgtgttcaccggtccttgctgcttatatggttacatgtcgctgtttgtacaaaacaacgatgaataaaattatacaatagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0859300, RefSeq:Os01g0859300

  1. 1.0 1.1 1.2 Zou M, Guan Y, Ren H, et al. A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance[J]. Plant molecular biology, 2008, 66(6): 675-683.
  2. 2.0 2.1 2.2 Zou M, Guan Y, Ren H, et al. Characterization of alternative splicing products of bZIP transcription factors OsABI5[J]. Biochemical and biophysical research communications, 2007, 360(2): 307-313.
  3. Brocard I M, Lynch T J, Finkelstein R R. Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response[J]. Plant Physiology, 2002, 129(4): 1533-1543.
  4. Gampala S S L, Finkelstein R R, Sun S S M, et al. ABI5 interacts with abscisic acid signaling effectors in rice protoplasts[J]. Journal of Biological Chemistry, 2002, 277(3): 1689-1694.
  5. Lu G, Gao C, Zheng X, et al. Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice[J]. Planta, 2009, 229(3): 605-615.