Os01g0205700
OsGSK1 (Oryza sativa glycogen synthase kinase3-like gene 1), a member of the plant GSK3/SHAGGY-like protein kinase genes, with enhanced tolerance to various abiotic stresses and an orthologue of the Arabidopsis brassinosteroid insensitive 2 (BIN2), AtSK21[1][2].
Contents
Annotated Information
Function
Please input function information here.
Mutation
- To examine the role of OsGSK1 in the abiotic-stress response, Serry Koh et al. analyzed the tolerance of OsGSK1 KO
mutants by measuring chlorophyll fluorescence and the wilting ratio after 8-day-old seedlings were treated with drought, cold, salt, or heat (Fig 1 and Table 1).
- Compared with our NT plants, the wilting ratios for KO mutants wereabout 20% lower after cold stress (4) and as much as 26% lower after heat (45) stress (Table 1).It is a transgenic rice with increased heat tolerance[1][3].
- The wilting ratios for KO were lower each 13% and 36% than NT plants by 100 mM and 250 mM NaCl treatment, respectively(Fig. 1A–C)For our drought-tolerance test, leaves from hydroponically grown 8-day-old KO and NT seedlings were air-dried on filter paper. Under normal growing conditions, the ratio of Fv to Fm was 0.82 ± 0.01 for both KO and NT plants(Fig. 1D).
- However, changes in Fv/Fm values varied between these genotypes, showing a slower decline in the KO mutants. After 6 h of drought treatment, the KO ratio was reduced to 0.47 ± 0.15, which was >2-fold higher than that of NT plants. These data indicated that the OsGSK1 KO mutant had enhanced tolerance to drought stress.
Expression
- OsGSK1 transcript was detected, at varying levels, in all these tissues or organs except for mature leaves. Expression was highest in the young panicles, with slightly less detection in the calli, implying possible physiological role of OsGSK1 in developing tissues.
- Northern blot analysis: Following cold treatment, transcript levels reached a maximum at 3 h, then decreased. Under salt stress, transcripts slightly increased. Drought stress caused a gradual decrease in transcript levels over 24 h. Under ABA treatment, expression was not significantly different from that detected in our control. These results indicate that OsGSK1 transcript accumulations are regulated differently by environmental stresses.
- GUS expression and morphological alteration of OsGSK1 KO mutant:
- GUS activity was strong in the root tips and root hairs but was more weakly detected in the shoots (Fig. 2A).
- In the latter, activity was localized to the lamina joint in the collar region. GUS activity also was detected in the vascular bundles of the coleoptile (Fig. 2E).
- In contrast to our Os-GSK1 KO, non-transgenic (NT) plants exhibited no GUS activity (data not shown). At the flowering stage, activity was highly detected in the entire young panicle (Fig. 2D).
- In the spikelet, GUS activity was found in the awn and vascular bundles of the palea and lemma (Fig. 2B).
- Whereas activity was strong in the stigma and rachilla, it was barely detected in the anther (Fig. 2C).
Evolution
- OsGSK1 was classified into Subgroup II with AtSK21, AtSK22, AtSK23, and OsSKetha (Fig. 3). Among those members, OsGSK1 had the highest similarity with AtSK21, which is known as a negative regulator of brass inosteroid signaling, BIN2[2][4][5].
- The Arabidopsis genome contains 10 GSK3/SHAGGY-like genes, and Brassinosteroid Insensitive 2(BIN2) encoding AtSK21[1][2]shares the highest sequence similarity to OsGSK1.
Knowledge Extension
Labs working on this gene
- Department of Life Science, Sogang University, Seoul 121-742, Korea
- Department of Biological Sciences, College of Natural Sciences, Seoul National University, Seoul 151-747, Korea
- National Research Laboratory of Plant Functional Genomics, Department of Life Science, Pohang University of Science and Technology, Pohang 790-784, Korea
- National key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan),Huazhong Agricultural University,Wuhan 430070,China
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0205700 |
|---|---|
| Description |
Similar to Shaggy-like kinase (Fragment) |
| Version |
NM_001048876.1 GI:115435165 GeneID:4327089 |
| Length |
2630 bp |
| Definition |
Oryza sativa Japonica Group Os01g0205700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:5773273..5775902 |
| Sequence Coding Region |
5773751..5773843,5773940..5774041,5774507..5774590,5774757..5774852,5774930..5774980 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:5773273..5775902 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:5773273..5775902 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>cagcttttcagagggttagcttatattcatactgttccaggagtctgccacagggatgtgaaaccacaaaatgttttggttgatcctctcactcatcaagtcaagctatgtgactttggaagtgcaaaggttctggttcctggtgaaccgaacatatcatacatttgctctcgctattatcgtgctcctgagctcatatttggtgcaaccgagtatacaacttcaattgacatatggtcagctggatgcgttcttgcagagttacttcttggtcagccactgtttcctggagagagtgctgttgaccagctagtagagataatcaaggttcttggtactccaacccgtgaggaaatacgatgcatgaaccccaactatactgagttcaaatttcctcagattaaggctcatccttggcacaagattttccacaagagaatgcctccagaagccatagaccttgcttcccgtcttctccaatattcaccaagtctacgctgcactgctcttgacgcatgtgcacattccttctttgatgagctacgagagcccaatgcacgcctgccaaatggtcgtccattccctcctctgttcaacttcaagcatgaactagccagcgcctctccagaactcatccacaggctcataccggatcatatcagacggcaacatggcctcaactttgcgcatgctgggagctaa</cdnaseq> |
| Protein Sequence |
<aaseq>QLFRGLAYIHTVPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKV LVPGEPNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVD QLVEIIKVLGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQ YSPSLRCTALDACAHSFFDELREPNARLPNGRPFPPLFNFKHELASASPELIHRLIPD HIRRQHGLNFAHAGS</aaseq> |
| Gene Sequence |
<dnaseqindica>2060..2152#1862..1963#1313..1396#1051..1146#923..973#678..818#163..219#1..78#cagcttttcagagggttagcttatattcatactgttccaggagtctgccacagggatgtgaaaccacaaaatgttttggtatgacttatgtgaacaaggctacattacttctcttgcttggttgtttgttttgaactggtctctaattgcttgctgatacaggttgatcctctcactcatcaagtcaagctatgtgactttggaagtgcaaaggttctggtatgttgatttccacccttaagagtaatttctcagtggtttgatgtatgctgaaattattctagtggtaggctagtcataatgttgacagcataagtggtttatttcgtcatgttgcttttacgtgtagatatgctgcttttgcctttcatgattgatttgtgatagaagttaaaatttgcactgtgctgggatagacttttttagatagctcaatagttaataaaagaaattgcctatcatgatcaatatttccaaattggttttatcatgtgctgttattatgtcgaaggattgttaagtttattaagttggatgcaaagttgctgagctaggactataatgatgaattcctgagcttggattataactgttggcctctcttccctagttctgttatttcttcattttgctattttaacaaatagattgatgatctccttgtactattccaccaggttcctggtgaaccgaacatatcatacatttgctctcgctattatcgtgctcctgagctcatatttggtgcaaccgagtatacaacttcaattgacatatggtcagctggatgcgttcttgcagagttacttcttggtcaggttagtcactatatctttatctaaggaactgcaacattcaggttccttgattagattatgctgtgatgttattctgattatatttcataatgtgtatttgtcagccactgtttcctggagagagtgctgttgaccagctagtagagataatcaaggtattgcatgatgttgtgcaagctacatttttttttttgccacgggtatttcttgtgttaacttgatattatggcaggttcttggtactccaacccgtgaggaaatacgatgcatgaaccccaactatactgagttcaaatttcctcagattaaggctcatccttggcacaaggtagccatgttttcttatattggatcaccttcctcataccattttacttgcagggcattgtaggccacttcaaaaccagtttctgcatcatgtttaatttgaaataaaaaaaatgtatctgcagctgcttaactgatccatctgttgttctttcgcttaccaccagattttccacaagagaatgcctccagaagccatagaccttgcttcccgtcttctccaatattcaccaagtctacgctgcactgctgtgagttttctttcgtttgcttagttttatattatctataaatctattgttttcgctaagcgctaggataatgattatttacatggatttgcttattttagcatttcatttcaagtgttgttagctgttacagtcaaatattcatagaccgtgtgtcaagaacaataaacgaaatgtttctgttgaggtcccttatggaagtagattgatggatccctggtcctgcatggtcattgtaattataatatccagtggtccaaaaccaaattggtgtgttggctggtgaagagtgagtgcaactttcatacagtcgcatgtgcctgttaaatatagttgttagtgctccacttgaaaaagttgctgttaattgtttaaagcttatgctttagctggaaaacagtataatctctaaagcagcatgctggacattttcaaagagcttagcatttggttgattatatgcagcttgacgcatgtgcacattccttctttgatgagctacgagagcccaatgcacgcctgccaaatggtcgtccattccctcctctgttcaacttcaagcatgaagtaagtaaacgagaacattttcaaacagtcgctttttatggtacatttatatttacctgtcatggatgcttatcaatgctcatttctggtatgcagctagccagcgcctctccagaactcatccacaggctcataccggatcatatcagacggcaacatggcctcaactttgcgcatgctgggagctaaagggcaccgcgacgccaccgttttgttcgtttatttttccatgagctggacattgcaatcctagatgactccattgtcctggacttggactccatctcagattgcaccatccatgttccatgatccatccatccgtcaagccatttccgcaaggactcagtaccagagaagaagtacaattatgtaaattatctaaccatggagaaatgcgtgctgctgctgctggtgttaagtacgtgacggggcatgctggttgagtagtaggtaaggttaaggataaatgtagttggtggagactgagagacatgttaagctagggaaccctgctttccttcttttttttttctcctttcattttggtttcttcccattttgtgatccttagcattgccctacagtagtgtagctgctccctgtttttgtttgctctttcatcatgtaaatgccaatcccaatcgcaatgaaccctctttccttc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 2.2 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4