Os03g0180800
The rice gene Os03g0180800 was reported as OsTIFY11a in 2008[1], a JA signaling gene and ZIM-3 in 2013[2], OsJAZ3 in 2013[3][4], respectively.
Contents
Annotated Information
Function
- For OsTIFY11a, the PCR products were cloned into p1301H (modified based on pCAMBIA1301) which has the stress-inducible promoter of OsLEA3-I[1][5].
- JA signaling gene Os03g0180800 was up-regulated by FA exposure[2]. Overexpression of ZIM-3 (Os03g0180800), a stress-inducible gene, was found to significantly increase tolerance to salt and dehydration stresses[1][2].
Mutation
(non) over-expressed lines[1]:
- four OsTIFY11a over-expressed lines:
- H6
- H8
- H10
- H13
- four non over-expressed lines:
- H2
- H3
- H7
- H11
- the over-expression of transgenic lines showed significantly increased tolerance to the stress treatments in terms of the shoot growth.
- OsTIFY11a-overexpressed lines accumulated significantly higher content of proline than the nonover-expressed lines under the salt stress conditions.
- When the seeds of OsTIFY11a transgenic plants were germinated on MS medium containing 75 mM NaCl, the over-expressed transgenic seeds had a significantly higher germination rate than the non-overexpressed transgenic seeds, but they showed no difference in germination rate on the normal MS medium.
Expression
- The full length cDNA of OsTIFY11a for overexpression was isolated from indica rice Minghui 63 and encodes a protein with the sequence as from japonica rice. OsTIFY11a and OsTIFY11e had similar induction dynamics: the induced expression peaked at 0.5 h after JA treatment[1].
- Over-expression of OsTIFY11a, one of the stress-inducible genes, resulted in significantly increased tolerance to salt and dehydration stresses. The OsTIFY11a gene was expressed in the 3–5 cm young panicles at a relatively high level. Interestingly, almost all of the OsTIFY genes with a high expression level in leaves had a very low expression level in the stamen[1].
Subcellular localization
The transient gene expression assay using Arabidopsis mesophyll protoplasts showed that the OsTIFY11a-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the nucleus, suggesting that OsTIFY11a is a nuclear protein[1].
Evolution
- A few OsTIFY gene clusters, including two OsTIFY gene clusters (OsTIFY11a, OsTIFY11b, and OsTIFY11c; OsTIFY11g and OsTIFY10a), on chromosome 3 and one gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d) on chromosome 10[1].
- OsTIFY11a contains a TIFY domain and a Jas motif, but two amino acids (Pro and Tyr) that were identified in the Jas motif are absent in OsTIFY11a[1].
- The 38 TIFY proteins were also classified into two major groups (I and II) according to the unrooted phylogenetic tree (Fig. 1). Four proteins with the GATA zincfinger and CCT domains (OsTIFY1a, 1b, 2a, and 2b) were clustered together in group I. The proteins without the GATA zinc-finger and CCT domains consist of the second major group (group II), and this group contains all the JAZ proteins of Arabidopsis and putative JAZ homologs in rice (OsTIFY3, 5, 6a, 6b, 9, 10a, 10b, 10c, 11a, 11b, 11c, 11d, 11e, 11f, and 11g)[1].
Knowledge Extension
The TIFY family is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes, such as development and responses to phytohormones, in Arabidopsis. However, there is limited information about this family in monocot species[1].
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
References
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Ye H, Du H, Tang N, et al. Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice[J]. Plant molecular biology, 2009, 71(3): 291-305.
- ↑ 2.0 2.1 2.2 Chi W C, Chen Y A, Hsiung Y C, et al. Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid[J]. BMC genomics, 2013, 14(1): 351.
- ↑ Lee H Y, Seo J S, Cho J H, et al. Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants[J]. PloS one, 2013, 8(1): e52802.
- ↑ Shimizu T, Miyamoto K, Miyamoto K, et al. OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice[J]. Bioscience, biotechnology, and biochemistry, 2013, 77(7): 1556-1564.
- ↑ Xiao B, Huang Y, Tang N, et al. Over-expression of a LEA gene in rice improves drought resistance under the field conditions[J]. Theoretical and Applied Genetics, 2007, 115(1): 35-46.
Structured Information
| Gene Name |
Os03g0180800 |
|---|---|
| Description |
ZIM domain containing protein |
| Version |
NM_001055701.1 GI:115451130 GeneID:4331832 |
| Length |
1035 bp |
| Definition |
Oryza sativa Japonica Group Os03g0180800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:4210340..4211374 |
| Sequence Coding Region |
4210735..4211274 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MASTDPMTRRFAVACGVLSQYVKANSSQPSTAAPVAQGVSGLMA AAAAAAAAPVVQEPGCEVDGGGQQFTIFYAGKVVVIDRCTPAMAAELMRFASAAQGGG GAPEAPPALVDMPIARKASLKRFLAKRKATPASARSSYVVRAAAAEEEQPPAKKAKAA VERREDWLALGSLGHMHSR</aaseq> |
| Gene Sequence |
<dnaseqindica>101..640#atatgtgatcagcgacgtacagtacagatcgttcgcaataaagttagacttctcgtctctctttgtgcttgtgcttagttgtccgtgctagaagacggcaatggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctgatgatcatcgccacgacgtcacgtctgcgatttgagaattgagagctcgatcgattgatcgccatgtggtcacccggtagccgatgctgcaaggccggtcgagttggaagatggttctcgtcgcattaacggccttgagttgatttcgccgagcctgaccttgagttgattaccatggaagtatgaagatttcgtgattagcagttaccctagttatcgcggcgtataattaagcacggtcactgaagcgcaatggccttgagtcggtagatcaggactagagaggggtgtatggatctgacaagtactgtagtatattgtatcccgtttgaattttttttcgattcctatggggactgaattgattaatgatataaaattccttcgactgttctg</dnaseqindica> |
| External Link(s) |
