Os06g0610300
Please input one-sentence summary here.
Contents
Annotated Information
Function
The 'MOC1' gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth [1]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3,4], and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6]. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os06g0610300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001064587.1 GI:115468905 GeneID:4341506 |
| Length |
626 bp |
| Definition |
Oryza sativa Japonica Group Os06g0610300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25189473..25190098 |
| Sequence Coding Region |
25189730..25189909 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq> |
| Gene Sequence |
<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica> |
| External Link(s) |