Os06g0139000

From RiceWiki
Revision as of 04:01, 13 May 2014 by Lilly3850 (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Figure 1. Comparison of morphological characters between ddf1-1 and wild-type plants .(from reference)[1]).
Figure 2. Histological characterization of the leaf, root and stem of ddf1-1 plants .(from reference)[1]).

controlling monocot vegetative and reproductive development ddf1-1 exhibits significant size reduction in the whole plant, except the spikelet.Cell division and cell expansion are inhibited in ddf1-1. [2]The expression of cell division/expansion-related genes is downregulated in ddf1-1.ddf1-1 also shows significant structural abnormalities in florets.[3]The ddf1-1 phenotype is caused by a single nucleotide substitution.DDF1 encodes an LRR-type F-box protein, anchored in nucleolus.The expression pattern of DDF1 is consistent with the phenotypes of ddf1-1.DDF1 regulates the expression of several floral organ specification genes[1].DDF1 encodes an LRR-type F-box protein, anchored in nucleolus.The expression pattern of DDF1 is consistent with the phenotypes of ddf1-1.DDF1 regulates the expression of several floral organ specification genes.

Expression

The mutant ddf1-1 was discovered from a breeding population.The ddf1-1 plant is much shorter and thinner than the wild type, and this difference is distinct at the early seedling stage and becomes more apparent as the plants develop. The final plant height of the mutant reaches only about half of that of the wild type (Figure 1a–e and Figure S1)[1][2]. All vegetative organs in ddf1-1, including stems[2], internodes, leaves and roots (both fibrous and lateral), are significantly shorter and thinner than in the wild type (Figure 1f–j and Figures S2 and S3). In addition, the ddf1-1 panicle is also notably shorter and smaller,[2] consisting of fewer primary and secondary branches and spikelets (Figure 1e,f; Figure S4). These phenotypes suggest that plant growth in ddf1-1 is seriously stunted. However, the size of the spikelet[2], the numbers of various vegetative organs[2][1] (e.g. internodes and tillers; Figure S5) and the time from sowing to heading (Figure 1e) remain unaffected in ddf1-1.

Evolution

You can also add sub-section(s) at will. Studies have indicated that F-box genes play crucial roles in a number of biological processes in plants,including flower development, self-incompatibility, hormone,response, circadian clock and photomorphogenesis,senescence, defense response, embryogenesis and seedling development (Moon et al., 2004; Lechner et al., 2006;Jain et al., 2007; Schumann et al., 2011). Until now, however,our knowledge about the functions of F-box genes in plants has remained very limited. Fewer than 5% inArabidopsis F-box proteins (Schumann et al., 2011) and only a few proteins in Oryza sativa (rice; Gomi et al., 2004; ª 2012 The Authors 829The Plant Journal ª 2012 Blackwell Publishing LtdThe Plant Journal (2012) 72, 829–842 doi: 10.1111/j.1365-313X.2012.05126.xIkeda et al., 2007; Jain et al., 2007) have been characterizedfor their functions.The model is also applicable to rice, with modifications,although monocot flowers are quite different from eudicot in morphology(Ambrose et al., 2000; Lee et al., 2003; Nagasawa et al., 2003; Whipple et al., 2004; Kater et al., 2006; Yamaguchi et al., 2006; Dreni et al., 2007; Ikeda et al., 2007). In rice, the functions of B-class genes OsMADS4 and OsMADS16 were proven to be largely conserved (Nagasawa et al., 2003), whereas the functions of C-class genes OsMADS3 and OsMADS58 were shown to have diverged from the Arabidopsis AGAMOUS gene, and the carpel specification appeared to be mainly determined by a distinct non-MADS-box homeotic gene DROOPINGLEAF (DL; Yamaguchi et al., 2004, 2006). Nevertheless, a recent study on the Osmads3 Osmads58 double mutant suggestedthat the two genes together exhibit a complete C-function in rice (Dreni et al., 2011).

Labs working on this gene

  • Plant materials
  • Microscopic observation
  • Scanning electron microscopy observation
  • Positional cloning of DDF1
  • Promoter activity analysis
  • Subcellular localization
  • Real-time quantitative PCR
  • mRNA in situ hybridization

References

  1. 1.0 1.1 1.2 1.3 1.4 李生平1, 段远霖1,2, 陈志伟. (2011) 水稻生长发育多效基因DDF1 的遗传分析与基因定位. 33(12): 1374―1379.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 Yuanlin Duan1, Shengping Li1, Zhiwei Chen1. (2012)Dwarf and deformed flower 1, encoding an F-box protein,is critical for vegetative and floral development in rice(Oryza sativa L.). The Plant Journal, 72: 829–842
  3. Ambrose, B.A., Lerner, D.R., Ciceri, P., Padilla, C.M., Yanofsky, M.F. andSchmidt, R.J. (2000) Molecular and genetic analyses of the silky1 gene reveal conservation in floral organ specification between eudicots and monocots. Mol. Cell, 5: 569–579.

Structured Information

Gene Name

Os06g0139000

Description

Conserved hypothetical protein

Version

NM_001063278.1 GI:115466287 GeneID:4340059

Length

5003 bp

Definition

Oryza sativa Japonica Group Os06g0139000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:2056222..2061224

Sequence Coding Region

2056559..2056939,2057034..2057180,2057282..2058094

Expression

GEO Profiles:Os06g0139000

Genome Context

<gbrowseImage1> name=NC_008399:2056222..2061224 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:2056222..2061224 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccaatgcgggatgctgcccgagctgcctgtgtgtctcattcctttctaagttcctggagatgccaccccaacctcaatttcagtagtgaagcattggggttgagcaaaaatgcatatggaaacgaagaattggctggacttttctacagcaaagtcaaccacattctcaaaaggcactcaggcatcggcgtgaaaaaactgacgattaaggtatattcagattatagtgggaagggctcttcatatctcaacaattggcttcagattgctgttaaaccagggattgaagaactcataattgcactgacccagttccaggcaaagtacaatttcccatgctctcttctgtcgaatgggagtggagactcaatccaatatcttcacctttctaactgttccttccacccaacagtcacacttagtggcttaagaagtctgacgagattgtatctttgtcgtgtgcgtattaccgagaacgagttaggctgccttctttcccattctcttgcattggagcagttggaaatcaggtactgcaataggatagtttgcctgaaggtaccttgcctactgcaacggctcatctccctgaaggtgtttgggtgtgacaagttgaaactgatagaaaatgaagctcctaatgtctccatgtttgcatttcaaggggacaaaacggaactgaaacttggagaaactttgcaaataaagagcctatgcatggtccgctctggttatgtttatcatgctcgtgctgaacttccatccatcatgccaaatcttgaatctcttgccctaaagtcatgcaaagagacggcctttgcaccgaagctgtgtagcaaattcctctgcctcaggcacttgagcattggccttattggatttttcccagcctatgactatttatccctggcttcttatatttatgctgcaccttctctggagacttttgacttgaatgtaatgcagcggaacgtgcagagtgtttcaatttttgcacatcctgcagatctgagatcaatacgagaagagaagcatcacaaccttaagagtgtgacggttacatcattcatctctgtaaagagcttggttgagctgacatgccatatccttgagagtacagcttcactcgagtgcttgacattggatgcttctcagactggttttaggtgtgatactccaggcagcaaaatcagcaaatgccccccactagatagggacattatcatggaaggtcacagaggggtcttggctatcagaagatacatccagcctagggtaccttccacagtgaagctgactgttttggagccctgcagctgccattccactgaactttag</cdnaseq>

Protein Sequence

<aaseq>MPMRDAARAACVSHSFLSSWRCHPNLNFSSEALGLSKNAYGNEE LAGLFYSKVNHILKRHSGIGVKKLTIKVYSDYSGKGSSYLNNWLQIAVKPGIEELIIA LTQFQAKYNFPCSLLSNGSGDSIQYLHLSNCSFHPTVTLSGLRSLTRLYLCRVRITEN ELGCLLSHSLALEQLEIRYCNRIVCLKVPCLLQRLISLKVFGCDKLKLIENEAPNVSM FAFQGDKTELKLGETLQIKSLCMVRSGYVYHARAELPSIMPNLESLALKSCKETAFAP KLCSKFLCLRHLSIGLIGFFPAYDYLSLASYIYAAPSLETFDLNVMQRNVQSVSIFAH PADLRSIREEKHHNLKSVTVTSFISVKSLVELTCHILESTASLECLTLDASQTGFRCD TPGSKISKCPPLDRDIIMEGHRGVLAIRRYIQPRVPSTVKLTVLEPCSCHSTEL</aaseq>

Gene Sequence

<dnaseqindica>4286..4666#4045..4191#3131..3943#gggctccttcctaaaattataactctgatatctatatctatcttgcctacaaattataactctcgttccccaattttgtgtgtgacgttgagaagtgccgaccggcgacgacgaaaggccggcggagagagatcccctcaccaccatggggatgctggatctgatgcgcctcatgtccatccagcgccagcgggaccaggagcgccgccgccgccaagcccaagctcccccccgtggtaaagaaactactcctcataagcttcctctcccacctccctctgtcactctctggtcaagcggcggcagcagcagcagcttcttgcgtttacggtgggggaagggaaccagatggacttgcttgcgcctctttttcctgtttcgttgggtgggtgtttatttagttttcttcacactagtttgtgtcgattattcgaatctgtatatatgtagtactagtatatacacaaaccaaaaagaaaaaaaaacatgtttttattgagcgcaaggtaggagatcaaaggtggtttatccgatccgccatggctggtggccggccaccaccgtcttgttccttttctctttaactagattgacgagacgtagggagagagactacactgtaactataaggtacccgcgtgttgctgcgggaattcttagaacaatatttgtgcgtatggtcgcatggatagcaaaaacactgaattgcattgaagtaagacaacctctttttgtgtgaatatggagttacggttttgttcaacattcaaatcagttgtgaaatatgaggatatatatcttggtagctgacaatttagatattaccgtgggcaacagaaaaagaaaaatgtttagtaatactgtgagaacttggctaatgatgataattcaaaatcatatacattgctccccaagttggataacagggttagcaaaaaaaaattcatattcagatatgaaagaaggttcagcagataaacatggctattaaaattcagttaccgaacaaggttcaccaactaaaaatttccatcaaaattaagagttttacgcacctcaatattatacttagactacgaatcaaccaactgatggtcttgtttcctgcattcttcaattgcttaaaaagaagaaaaggatctgacaatgaaaccacagctacatagggcatcgacagaaagtggttaaagttgtaactgcatatctacatagcagcatacgatagacacataattgaaaggtccagattagcatagcttcaagcatcataaaacatgaagctagtcatgggtggaaagattctgtggaaggacagggataataagcatattgatttgaacctgcgggagtggcatatcctgagagagataagttgtgttgggaaggctcatcagctagtgtcgttgaccagagtgagtttgtcatcgtcgccggaggatacagctcgtctttctctctcccatgaagatctggcagcatagctgagagcctttgagaggaaaggagaaggcatattgagggtaataaatgtccatggcggctgtcacttcaactcctagctgtttcaggttttgatagcgcgtttcagcctttcaggcgagggagactcaaaggtggacatagaagccgaatggctcagttctcttgcgtcgtgttgcgctgagagtggagatggaacgataggaggtaggatgttctggggtacgtaggaacgtttggttgggttttctgtgtgagagacactacattcaatctgatggaaattaaggggtgatgtggcaaagcgagatgaccaaaaaaatactattaattgcactaagtggggatgaattgtatcggtttataggatactatactatgcaaaataagaaaaatactatatgacatgctgaacttcagacatttccccttaaattgataacactttgatttcttttacaaactgttagtgttgttgtacaaaaggggacaaaaaaaaaaataacggattgccatgtgtgcaatggtgtgcttgcttgaattttctgtttattcctgaaatggatgtaaaccatgcatcttgtgctgcagatggattgattgctttacgggctaaaagaaaagggctcaccctgccaacaagacggcgattctcagggtgctgctgacatagagataccaagccttccagaggtacaccataaataaaatgttgatgatgaaacatcttactagtagtgtagtacaagtaaattatgacgattactgcttgaatcgcacaaatcggtcgaccaacgttattaaagtttatgaacggagcactttgatgctataacctcctacagctgctgcattggaactgtttttccagctgttgcacttactttcaattacaagttgtgtccacataatgcttgcttctaagctggtggttcttaggctgggagtttctcaagtcaacgtcaatgattagcctttgccactagtctccatactgtttctaacttccttaaattttaacatctcaaaaatggttccttgctaacaaatgtgacatgttatctccggtaggccattgcaggcagtacatggtaattttgtgagccacatgtccttgtaggatggcattcttgtttgattccccgcatctccccatcctgactccccgcatcttccccatcctgagttcctgacctagtgtatgaaaatccaagcaagcaaccaaacacacctttagttctgttacatatttaactgatctttctggttgtttatatattcagatattggtaccctatgcaaagtgcatgtccatttctgttccttttatgccattgaataacatgctattagacaattaaacatcattccatccattttatctggcacaattgcaaagaaacaaatagtgccgagcacctaatacatgatttgggtaagaccatatttgcctagcagaagtcaactatacaattcatagtacaatagtacataatcaggcaggtagcactggaccggttaaagtgttaactccataagttaccattttttttcttccatctaattcaaccatctgtcttcacaattccaatggttaacttctctcccatgcttgtgcaagcaggacatctggcgtcttatacattccttgatgccaatgcgggatgctgcccgagctgcctgtgtgtctcattcctttctaagttcctggagatgccaccccaacctcaatttcagtagtgaagcattggggttgagcaaaaatgcatatggaaacgaagaattggctggacttttctacagcaaagtcaaccacattctcaaaaggcactcaggcatcggcgtgaaaaaactgacgattaaggtatattcagattatagtgggaagggctcttcatatctcaacaattggcttcagattgctgttaaaccagggattgaagaactcataattgcactgacccagttccaggcaaagtacaatttcccatgctctcttctgtcgaatgggagtggagactcaatccaatatcttcacctttctaactgttccttccacccaacagtcacacttagtggcttaagaagtctgacgagattgtatctttgtcgtgtgcgtattaccgagaacgagttaggctgccttctttcccattctcttgcattggagcagttggaaatcaggtactgcaataggatagtttgcctgaaggtaccttgcctactgcaacggctcatctccctgaaggtgtttgggtgtgacaagttgaaactgatagaaaatgaagctcctaatgtctccatgtttgcatttcaaggggacaaaacggaactgaaacttggagaaactttgcaaataaagagcctatgcatggtccgctctggttatgtttatcatgctcgtgctgaacttccatccatcatgccaaatcttgaatctcttgccctaaagtcatgcaaagaggtatgagaaattttacctgacacactaatgataggcatatctaatgagactagattctgtcttatgggttgtagcataattaatttgacctctttatgcagacggcctttgcaccgaagctgtgtagcaaattcctctgcctcaggcacttgagcattggccttattggatttttcccagcctatgactatttatccctggcttcttatatttatgctgcaccttctctggagacttttgacttgaatgtgagtagctgttcatatattattactgctatgaatgaaattagtagctgtgtggtggaaatgtcacttaaaatttctccctttcacatcctaggtaatgcagcggaacgtgcagagtgtttcaatttttgcacatcctgcagatctgagatcaatacgagaagagaagcatcacaaccttaagagtgtgacggttacatcattcatctctgtaaagagcttggttgagctgacatgccatatccttgagagtacagcttcactcgagtgcttgacattggatgcttctcagactggttttaggtgtgatactccaggcagcaaaatcagcaaatgccccccactagatagggacattatcatggaaggtcacagaggggtcttggctatcagaagatacatccagcctagggtaccttccacagtgaagctgactgttttggagccctgcagctgccattccactgaactttagatgtcatgtttatcttagttattcgatgtttaatcgtgctgctgctgatgatgattctgtagattcttagatgggtcatggtttctaaagtttgctcttaatgattactactagttgatatcataaccaatgcacatgatatccactagtaactctagtttccacctagcagcagtgttgtatgcacattaaaaagttcttactagcagaagttctcgaacgtttgatttacctacttgtggccttgtgggttataaaaagctaaacattagagtttgtaacaaattttagtgtgtagcctttaatttcttttcacctatatatgcatcggtttctt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0139000, RefSeq:Os06g0139000