Os06g0622700

From RiceWiki
Revision as of 16:28, 19 May 2014 by Li150706345 (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

  • Os06g0622700 is a homolog of ATbZIP60. The Os06g0622700 bZIP transcription factor

plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.


Figure1.RT-PCR expression profile of a rice bZIP transcription factor containing a TMD.


  • Figure1:(a) Expression during seed development.

(b) Expression under ER stress conditions in callus. (c) Induction of GUS activity by T2 callus containing the Os06g0622700 promoter:GUS construct after treatment with 2 mM DTT for 6 h. The photographs on the bottom left show GUSstained calli with or without DTT treatment (scale bars = 1 mm). The bottom right panel shows quantitative measurement of GUS activity in these calli [4-methylumbelliferone (4-MU) production rate over 1 h]


  • Os06g0622700 is one of the most important transcription

factors involved in signal transduction of the ER stress response in rice.


Figure2.Effect of Os06g0622700 on some chaperone gene promoters in rice suspension cultured cells.


  • Figure2:(a) Effector, reporter and control vector constructs are shown.

Os06g0622700DC is the active form of the protein. (b) Fold change in GUS activity after transient expression.


  • The early stage of the ER stress response in rice is mediated

by OsbZIP50 (Os06g0622700), OsbZIP39 (Os05g0411300) and OsbZIP60 (Os07g0644100).

Expression

  • Expression of many chaperone genes induced

by the major BiP1 may be mainly mediated by binding of Os06g0622700 to UPRE or ERSE cis-elements, as expression ofmanychaperone genes induced byDTTtreatmentwasalso regulated by the Os06g0622700 bZIP transcription factor.


  • The Os06g0622700

as well as several protein folding-related genes that are regulated by OsbZIP50, such as Os08g0197700 (BiP paralog) and Os11g0197700 (PDI like 1-1) (Wakasa et al. 2011).

Evolution

Os06g0622700 is a homolog of ATbZIP60.

Os03g0102200 is a 14.5-kD polypeptide that is similar to DNA-directed RNA polymerase II, SDRP, while Os06g0622700 is a bZIP (for basic Leu zipper) transcription factor that shows the highest homology to AtbZIP60 in Arabidopsis (Supplemental Fig. S6), so we renamed it OsbZIP60.

Figure3.Structure of ZmbZIP17, and the alignment and phylogenetic tree generated with ER stress-associated membrane-associated bZIP factors from Arabidopsis, rice and maize.

Figure3:(a) Structure of ZmbZIP17 and ZmbZIP17�C. The map of the full-length ZmbZIP17 indicates the location of the putative bZIP, nuclear localization signal (NLS), transmembrane domains (TMDs) and the canonical S1P site. The map of the truncated protein ZmbZIP17�C indicates the deletion of TMDs and S1P domains. (b) Alignment of protein sequences for ZmbZIP17 and the known membrane-associated bZIP transcription factors. (c) The unrooted phylogenetic tree of ER stress-associated bZIP factors from Arabidopsis, rice and maize. The bZIP factors in (b) and (c) were AtbZIP17 (At2g40950), AtbZIP49 (At3g56660), AtbZIP28 (At2g17770), AtbZIP60 (AT1G42990), OsbZIP39 (Os05g34050), OsbZIP50 (Os06g0622700), OsbZIP60 (Os07g44950), ZmbZIP17 (BT040011), ZmbZIP28 (BT067808) and ZmbZIP60 (BT086464).

Labs working on this gene

Please input related labs here.

References

Hayashi, Shimpei, Takahashi, Hideyuki, Wakasa, Yuhya, Kawakatsu, Taiji, & Takaiwa, Fumio. (2013). Identification of acis-element that mediates multiple pathways of the endoplasmic reticulum stress response in rice. The Plant Journal, 74(2), 248-257. doi: 10.1111/tpj.12117

Hu, J., Zhou, J., Peng, X., Xu, H., Liu, C., Du, B., . . . He, G. (2011). The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding. Plant Physiology, 156(2), 856-872. doi: 10.1104/pp.111.174334

Lu, S. J., Yang, Z. T., Sun, L., Sun, L., Song, Z. T., & Liu, J. X. (2012). Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses. Mol Plant, 5(2), 504-514. doi: 10.1093/mp/ssr115

Oono, Youko, Wakasa, Yuhya, Hirose, Sakiko, Yang, Lijun, Sakuta, Chiyoko, & Takaiwa, Fumio. (2010). Analysis of ER stress in developing rice endosperm accumulating β-amyloid peptide. Plant Biotechnology Journal, 8(6), 691-718. doi: 10.1111/j.1467-7652.2010.00502.x

Takahashi, H., Kawakatsu, T., Wakasa, Y., Hayashi, S., & Takaiwa, F. (2012). A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response. Plant Cell Physiol, 53(1), 144-153. doi: 10.1093/pcp/pcr157

Wakasa, Y., Yasuda, H., Oono, Y., Kawakatsu, T., Hirose, S., Takahashi, H., . . . Takaiwa, F. (2011). Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm. Plant J, 65(5), 675-689. doi: 10.1111/j.1365-313X.2010.04453.x

Yang, Y. G., Lv, W. T., Li, M. J., Wang, B., Sun, D. M., & Deng, X. (2013). Maize Membrane-Bound Transcription Factor Zmbzip17 is a Key Regulator in the Cross-Talk of ER Quality Control and ABA Signaling. Plant and Cell Physiology, 54(12), 2020-2033. doi: 10.1093/pcp/pct142

Structured Information

Gene Name

Os06g0622700

Description

Eukaryotic transcription factor, DNA-binding domain containing protein

Version

NM_001064635.1 GI:115469001 GeneID:4341554

Length

1991 bp

Definition

Oryza sativa Japonica Group Os06g0622700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25918948..25920938

Sequence Coding Region

25918979..25919418,25919822..25920042,25920504..25920757

Expression

GEO Profiles:Os06g0622700

Genome Context

<gbrowseImage1> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacggaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctag</cdnaseq>

Protein Sequence

<aaseq>MDVEFFADLDLDALLASFSSSAAAAGSGVSGLFAPSPPHDAEAG SPESVSSRRPSPSREAALSEIERFLMEEGPAAEEGVGAEDFFDALLVDGGEEEEEEEG KGSEAGGSTDGDSGKENEVATPDAEKEDVEAEVDGDDPMSKKKRRQMRNRDSAMKSRE RKKMYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQSLLKDRPVGAATAMQESAV LTETLPLVSLLWLVSIVCLLPVPGLPNRNPVARSSAGRDLATVTGKKTSSEQQLEETL LLHGRRCKGSRARIKLDTGPFRLAAAAC</aaseq>

Gene Sequence

<dnaseqindica>32..471#875..1095#1557..1810#gagagacaaaaatatctccatcgcgatctccatggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggtatgtatgaattgcctaaaaacttgggatttctaaaaatcagggggatttcgtgtgtacaaagatttgtgaatttacataggtagctaggaataatggtcaggttttagttcaacacaattgatcttattcagtgagtgccagaagtccagaaccgcactacacccatagtacattttttttattaattaaaacattatatatgtacatacatgagtatatgatctaatttgtcgtaataagatgcatggtctttttagtgctaatcctttgtgaaattgtaagaaattgctaggctttcaattataagagtgtatggtcttttcaactataagatgttttccgtaatcaaagatgttctagttagacaataatctaatagtatgtgttatgaatttatcaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacgggtaagacatatcgacaacattttctgtttcatacttctatttcgacatggatgaacaaatcttttcttgccgatcattttgaattgctcagtatgctgacaaacttgtgcttggcatcaatatattcggtgtggtctcatggatgatccgcctaagctaatttttgttgaattcccatgaaatcaaacagctagctattgtagttatagccaattgttgactacattttctgtgtacaagtatgcgtggtttatgcacaaatctgcattgtttatacaataacacttgcttagccttttgttttccaactttggacctaatcagtcaccgaccgaagttgacattaactggaacatggtttctttgctatcctacagtatgcttgagtcataatcctgatgctcctacagtatatttgtgtcataaacctgatgctaaaggtaaccttttcctgtttgcagaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctaggctgccgcttccttgcaaagttgtttccagtctgtattgtagctagcaaatcaaattggcgtgtctatcgcctgtcgtgctgccgcttatccatggactatctttttctttttttggttccttccccccttgtttttataatatcctcctatgcataatgcattatccaggtagttttgaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0622700, RefSeq:Os06g0622700