Os04g0499300

From RiceWiki
Revision as of 01:34, 20 May 2014 by Chengjilong1205 (talk | contribs) (Evolution)
Jump to: navigation, search

The rice Rymv1 gene is well known as its resistence of the rice yellow mottle virus (RYMV).

Annotated Information

Function

Rymv1,rice yellow mottle virus disease resistant gene, encoding eukaryotic translation initiation factor isomer eIF (iso) 4G. Rmv1 initially located on chromosome 4 3.7cM interval SSR markers RM252 and AFLP markers E-ACG/M-ACA between the inner (Albar et al., 2003). Rymv1 located on chromosome 4, which corresponds to the position of Nipponbare sequencing atlas (5'-3 ') at 24766929 - 24761516 interval (Rice Genome Annotation Project). The isoform of the eukaryotic translation initiation factor 4G (eIF(iso)4G) plays in naturally occurring resistance in plant/virus interactions. A genetic and physical mapping approach was developed to isolate the Rymv1 locus controlling the high recessive resistance to Rice yellow mottle virus (RYMV) in the rice (Oryza sativa) variety Gigante. The locus was mapped to a 160-kb interval containing a gene from the eIF(iso)4G family. The stable transformation of a resistant line with the cDNA of this gene, derived from a susceptible variety, resulted in the loss of resistance in transgenic plants. The allelic variability of this gene was analysed in three resistant and 17 susceptible varieties from different cultivated rice species or subspecies. Compared with susceptible varieties, resistant varieties present specific alleles, characterized by either amino acid substitutions or short amino-acid deletions in the middle domain of the protein. The structure of this domain was modelled and showed that the substitutions were clustered on a small surface patch. This suggests that this domain may be involved in an interaction with the virus.

Expression

Rymv1 contains nine exons and 8 introns, encoding eukaryotic translation initiation factor isomer eIF (iso) 4G.In the IR64 and Gigante, Rymv1 cDNA coding region of 2379bp, which encodes a protein consisting of 793 amino acids, wherein the first range of 208 ~ 435 amino acid domain corresponding MIF4G; 628 ~ 740 amino acid domain corresponding to the section MA3.Compared with the encoded products of the susceptible parent, antiviral protein MIF4G domain deleted or three single amino acid substitution of amino acids occurs, the variation of resistance at the surface of the three dimensional structure of the protein, suggesting MIF4G protein interaction domains and may be involved in virus recognition (Albar et al., 2006).EIF4E and fixed plant eIF4G eIF4F complex formation, and eIF (iso) 4E and eIF (iso) 4G formed eIF (iso) 4F complex, these two protein complexes involved in the initial steps of the translation of mRNA cap structure and recruitment of the ribosome.

Evolution

[Note]

Rice yellow mottle virus disease occurs mainly in more than ten countries in West and Central Africa, such as Kenya. Mainly by leaf CPI (Apophylias spp.), Jump CPI (Chaetoenema spp.), Lobular A (Sesselia passilla) and African iron beetle (Trichispa sericeas) for semi-persistent transmission, also by sap inoculation.

Labs working on this gene

1 UMR 5096, IRD/CNRS/Universite´ de Perpignan, BP 64501, 34394 Montpellier CEDEX 5, France

2 UMR 1097, IRD/CIRAD/Agro-M/INRA, BP64501, 34394 Montpellier CEDEX 5, France

3 Africa Rice Center, WARDA, 01 BP 2031, Cotonou, Benin

References

Structured Information

Gene Name

Os04g0499300

Description

Initiation factor eIF-4 gamma, middle domain containing protein

Version

NM_001059754.2 GI:297602993 GeneID:4336300

Length

2548 bp

Definition

Oryza sativa Japonica Group Os04g0499300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:25344788..25347335

Sequence Coding Region

25345201..25346256,25346777..25347043,25347116..25347235

Expression

GEO Profiles:Os04g0499300

Genome Context

<gbrowseImage1> name=NC_008397:25344788..25347335 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:25344788..25347335 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagagaagggacaaagaaaggattgtcaaactaagaacacttggaaatatccgtctaattggtgagctacttaagcaaaagatggtacctgaaaagatagttcatcacattgttcaggaactcttggggtctggacctgataaaaaggcttgccctgaagaggaaaacgttgaggctatttgtcagttcttcaatacaattggtaaacagcttgacgagaacccaaaatctcgtcgaattaatgatacctacttcattcagatgaaggagttaacaacaaaccttcagttggcaccacgtctgaggtttatggttcgtgatgtggttgatcttcgttcaaacaattgggtgcctcgacgtgaagaggtaaataaaatcaccctaattaaggccaagacaatcagtgaaattcatgatgaggctatgaagacacttggactacggccaggggcaacaggactcacgaggaatggccgtaatgcaccaggtggtcctctttcccctggtggattcccaatgaatcgaccaggaacaggagggatgatgcctgggatgcctggaacacctggtatgcctggatcaagaaagatgcctggaatgcctgggttagataatgataactgggaagttccacgttctaaatcaatgccaagaggcgactctcttcgtaaccagggtccgttgcttaataagccatcatctattaacaagccatcatctattaactccaggcttcttcctcatggaagtggagcactaattggtaagagtgctcttttgggcagtggtggtccaccatctcgcccttccagccttatggctagtctcactcatacaccagctcaaactgcaccatcaccaaaacctgtaagtgcagctccagctgttgtgcctgtcacagacaaagcagccggttcttcccatgagatgccagctgcagttcagaagaagacggtatcccttcttgaagagtattttggcatacgtattctggatgaagcacaacaatgtatcgaggagcttcagtgtcctgagtactactctgagattgtgaaagaagctatcaatcttgctttggataagggtcccaacttcattgatcctcttgttaggctgctggagcatctgcacgccaagaaaattttcaagactgaggacctgaaaactggatgcttactgtatgcagccctgctggaagatattggtattgaccttcctctagctccagccttgtttggtgaagttgttgcacgactgagtttgtcgtgtggcttgagctttgaagttgttgaggagattctaaaagcagtggaggatacatacttccgcaaaggaatttttgatgctgtcatgaaaaccatgggcggaaactcttcaggtcaggctatattgagctcgcatgctgtggtaatcgacgcctgcaacaaacttttgaaataa</cdnaseq>

Protein Sequence

<aaseq>MERRDKERIVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG SGPDKKACPEEENVEAICQFFNTIGKQLDENPKSRRINDTYFIQMKELTTNLQLAPRL RFMVRDVVDLRSNNWVPRREEVNKITLIKAKTISEIHDEAMKTLGLRPGATGLTRNGR NAPGGPLSPGGFPMNRPGTGGMMPGMPGTPGMPGSRKMPGMPGLDNDNWEVPRSKSMP RGDSLRNQGPLLNKPSSINKPSSINSRLLPHGSGALIGKSALLGSGGPPSRPSSLMAS LTHTPAQTAPSPKPVSAAPAVVPVTDKAAGSSHEMPAAVQKKTVSLLEEYFGIRILDE AQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHAKKIFKTEDLKTGC LLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVVEEILKAVEDTYFRKGIFDA VMKTMGGNSSGQAILSSHAVVIDACNKLLK</aaseq>

Gene Sequence

<dnaseqindica>1080..2135#293..559#101..220#tacattcaagcgtgtgctgttgaacaattgtcaggaagcatttgaaggtgctgagagcctaagggctgaaatagcaaaattgactggccctgaccaagagatggagagaagggacaaagaaaggattgtcaaactaagaacacttggaaatatccgtctaattggtgagctacttaagcaaaagatggtacctgaaaagatagttcatcacattgttcaggtatgcattagcaaattggtaataaagttattattattcaggggtagcttgtctaatctgttctatatgcaggaactcttggggtctggacctgataaaaaggcttgccctgaagaggaaaacgttgaggctatttgtcagttcttcaatacaattggtaaacagcttgacgagaacccaaaatctcgtcgaattaatgatacctacttcattcagatgaaggagttaacaacaaaccttcagttggcaccacgtctgaggtttatggttcgtgatgtggttgatcttcgttcaaacaattgggtgcctcgacgtgaagaggtaaataaaatcaccctagtgttttattttagttatcttttatacatgcattgtctttctttcataatgacgttagtctcttggttgtaccgaggtgctgctatgagtactttggtcaatggctaccaaattctagcaccatagttatctgtagtggctctttaactgtgagcttattagataaacatgcatgctcatgtgggaatggcaagcaatcgccagtgctatgaaattgcatatatttatttagaatcaacgggtttgtctattgctttgtacacccctatattaataagagaatggccatgtttataatccatatttgaaataattcatcagttcaccgttttgactatacattgaagcattctgtttggtaccataatgttgtttctggcttacactaaatttaatgccaagtatggcttcaatgtttttgttcccactcttagtttgctgtttgtattagcaatcactggttagctggatttataaatttattatccattctgagttttgtgatgcttgcaatcttcagattaaggccaagacaatcagtgaaattcatgatgaggctatgaagacacttggactacggccaggggcaacaggactcacgaggaatggccgtaatgcaccaggtggtcctctttcccctggtggattcccaatgaatcgaccaggaacaggagggatgatgcctgggatgcctggaacacctggtatgcctggatcaagaaagatgcctggaatgcctgggttagataatgataactgggaagttccacgttctaaatcaatgccaagaggcgactctcttcgtaaccagggtccgttgcttaataagccatcatctattaacaagccatcatctattaactccaggcttcttcctcatggaagtggagcactaattggtaagagtgctcttttgggcagtggtggtccaccatctcgcccttccagccttatggctagtctcactcatacaccagctcaaactgcaccatcaccaaaacctgtaagtgcagctccagctgttgtgcctgtcacagacaaagcagccggttcttcccatgagatgccagctgcagttcagaagaagacggtatcccttcttgaagagtattttggcatacgtattctggatgaagcacaacaatgtatcgaggagcttcagtgtcctgagtactactctgagattgtgaaagaagctatcaatcttgctttggataagggtcccaacttcattgatcctcttgttaggctgctggagcatctgcacgccaagaaaattttcaagactgaggacctgaaaactggatgcttactgtatgcagccctgctggaagatattggtattgaccttcctctagctccagccttgtttggtgaagttgttgcacgactgagtttgtcgtgtggcttgagctttgaagttgttgaggagattctaaaagcagtggaggatacatacttccgcaaaggaatttttgatgctgtcatgaaaaccatgggcggaaactcttcaggtcaggctatattgagctcgcatgctgtggtaatcgacgcctgcaacaaacttttgaaataatagccccttggcagccttggcatatcaaccttttggatgctgtgcctagccaaaacagcatcgtgtattctctatagcttaggtgtttcaccccagaggaactctcgtactggagatgtgagcaacagccagttttgtgctgtatatttttgcaaggtcagatgagtgttcattattgtttcgacaacgaaggaaagaaagaagccatggattttgctatcgggtgacagcttaattcgctggagcctgagatgaacaaggcttaatgtggtatttttgtgtccctttattagttcttttctgtgcgtacacattttgtaacaatgtactatggttttggagtattctgttggtttacaatatatcgtgtcattgtagcggtcaaattttgatacctaattctgaggtttgct</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0499300, RefSeq:Os04g0499300