Os10g0573400
Please input one-sentence summary here.
Contents
Annotated Information
Function
Abscisic acid (ABA) is an essential phytohormone that regulates plant stress responses. [1] The gene Os10g0573400 possesses most of the key protein functions of ABA-related genes. Studies on rice ABA receptors are compulsory to know the properties of ABA and this gene has significance in expressing one of ABA receptors named OsPYL1 in rice. In two species (A. thaliana and O. sativa), duplicate genes include Os10g0573400 related to ABA signaling pathways contribute to the expression variation in different organs or stress responses. [2]
Expression
This gene is related to the expression of ABA metabolism and its signaling pathways. Key protein functions of ABA metabolism are not fully conserved and tend to be unique in each of the species studied. ABA synthesized in vascular tissues is transported to other locations such as guard cells, roots or seeds but cellular processes in targeted cells are due to the expression of genes related to ABA signaling pathways. Proteins related to ABA signaling pathways may have a higher expression variation among different organs or stress responses in comparison with those of ABA metabolism. [2]
Evolution
It is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens.Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters. [1]
Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species. [2]
OC7 includes PYR1, PYL1, PYL2, PYL3, PYL4,PYL5, PYL6, PYL7, PYL8, PYL9, PYL10, PYL11, PYL12, and PYL13 (underlined). Genes of A. thaliana, A. lyrata, P. trichocarpa, O. sativa, S. moellendorffii, and P. patens begin with"AT","Araly1","POPTR","Os","Selmol"and "Phypa1_1", respectively. [2]
Labs working on this gene
Gene Discovery Research Group, RIKEN Plant Science Center,1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama,Kanagawa 230-0045, Japan State Key Laboratory of Bio-membrane and Membrane Biotechnology, Beijing, China Center for Structural Biology, School of Medicine, Beijing, China School of Life Sciences, Tsinghua University, Beijing, China
References
<references> [1]
Structured Information
| Gene Name |
Os10g0573400 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001072002.1 GI:115483599 GeneID:4349472 |
| Length |
1089 bp |
| Definition |
Oryza sativa Japonica Group Os10g0573400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome |
{{{Chromosome}}} |
| Location |
Chromosome 10:23221607..23222695 |
| Sequence Coding Region |
23221741..23222379 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq> |
| Protein Sequence |
<aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq> |
| Gene Sequence |
<dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.
- ↑ 2.0 2.1 2.2 2.3 2.4 Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.

