Os05g0429900

From RiceWiki
Revision as of 02:50, 25 May 2014 by Zhangamanda (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

PathwayId of the Os05g0429900 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.

Expression

Prediction of subcellular targeting by using the TargetP and WoLF PSORT prediction programs suggested that Os01g0919900, Os01g0880800, and Os08g0199400 are localized in the chloplast or mitochondrion, whereas the others are present in chloroplasts.

Fig. 1. RNA blot analysis.


Fig:Transcripts of OsSSI2, two OsSSI2 homologs, WRKY45, and PR1b were analyzed in wild-type (WT) and OsSSI2 mutant plants. OsSSI2 transcripts were not detected in homozygous Osssi2-Tos17 (NF7039) and OsSSI2-knockdown (kd) plants, whereas the expression of the two closest homologs of OsSSI2 (i.e., Os04g0379900 and Os01g0880800) was unaffected in these plants. The arrow indicates a band of fusion transcripts encoding OsSSI2 with the Tos17 insertion. The salicylic acid/benzothiadiazole-induced gene WRKY45 and the pathogenesis-related gene OsPR1b were constitutively expressed in the NF7039 and OsSSI2-kd plants. Leaf blades from the fourth leaves of seedlings were used.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Plant Disease Resistance Research Unit, Division of Plant Science, National Institute of Agrobiological Sciences, Kannondai , Tsukuba, 305-8602 Japan; College of Agriculture, Ibaraki University, Ami 300-0393, Japan

Shanghai Agrobiological Gene Center, Shanghai, P. R. China CAS Key Laboratory of Separation Science for Analytical Chemistry, Dalian Institute of Chemical Physics, Chinese cademy of Sciences, Dalian, P. R. China National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, P. R. China

References

Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.

Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu� and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.

Structured Information

Gene Name

Os05g0429900

Description

Similar to MybHv5 (Fragment)

Version

NM_001187510.1 GI:297724150 GeneID:9266213

Length

1279 bp

Definition

Oryza sativa Japonica Group Os05g0429900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:21106104..21107382

Sequence Coding Region

21106375..21106894,21106995..21107257

Expression

GEO Profiles:Os05g0429900

Genome Context

<gbrowseImage1> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:21106104..21107382 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatga</cdnaseq>

Protein Sequence

<aaseq>MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAA GLLRCGKSCRLRWMNYLRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDN EIKNYWNTHIKRKLLARGIDPQTHRPLLSGGDGIAASNKAAPPPPHPISVPAKAAAAA IFAVAKPPPPPRPVDSSDDGCRSSSGTTSTGEPRCPDLNLELSVGPTPSSPPAETPTS ARPVCLCYHLGFRGGEACSCQADSKGPHEFRYFRPLEQGQYI</aaseq>

Gene Sequence

<dnaseqindica>489..1008#126..388#ccgccgcggctcacctggaaactgggcagattggacaatcgctcgagcgagctagcgagagagagcgcgagagagcgaggcggcgcgcgcggtggttgcggatttgtagcttagagcgcggggccatggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtcagtctccctccccccgtctccggcgccgccgccaccgatcgatggagcattcatcaattccttgtgattctcaattcggtttcgcttcttctttcaggtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatgagatatgaccatgagatgtgagatggcttaattagcttcaattcccaacatgtgtaacacagggagtttttctagtggacgacaatactgtttaatttcagaaaaaaaaagggaaagaaaaaggttctaatctgttcatatttcttactattatccaatcttcatgatctcaatctctctctctctttattatttttctttgtagtaattaacttcatgttggttcctctaaaaaagattggtcgatgttattcagtgataaatattcctag</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0429900, RefSeq:Os05g0429900