Os01g0822900

From RiceWiki
Revision as of 06:10, 25 May 2014 by Mmma (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.[1]
  • Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf 1 (D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,[2] though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.


Genomic structure of the Psd1 locus.jpg Fig1. Genomic structure of the Psd1 locus[1].

Expression

Please input expression information here.

Figure 2. Expression analyses of five flowering-related genes of the Psd1 and ZH11 plants harvested at 12:00(from reference [1]).
]]
Figure 3. Phenotypic characterization of the Psd1 mutant and ZH11 wide-type plants grown in long-day and short-day(from reference [1]).
]]
  • It is expressed in elongating stem, vegetative sheath and young inflorescence.

(1)Expression analysis of flowering-related genes, Hd3a, RFT1, Ehd1, Ghd7and DTH8 in the Psd1 mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so Psd1 mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

(2)Psd1-related genetic network is regulated by day-length dependent signals. (Fig.3)

Wide Type VS Mutant

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 1.2 XXX
  2. XXX

Structured Information

Gene Name

Os01g0822900

Description

Similar to Lipid transfer protein

Version

NM_001051189.1 GI:115440748 GeneID:4327617

Length

901 bp

Definition

Oryza sativa Japonica Group Os01g0822900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:36885860..36886760

Sequence Coding Region

36886214..36886223,36886310..36886662

Expression

GEO Profiles:Os01g0822900

Genome Context

<gbrowseImage1> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>

Protein Sequence

<aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>

Gene Sequence

<dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0822900, RefSeq:Os01g0822900