Os02g0121300
Please input one-sentence summary here.
Contents
Annotated Information
Function
Os02g0121300 is a cyclophilin gene.It encoding OsCYP2 protein,which interact with co-chaperone Suppressor of G2 allele of skp1(OsSGT1) to effect the process of the degradation of auxin-responsive proteins.It is important in rice lateral root initiation. Futhermore, another study shows that OsCYP2 expression can be induced by salt stress and circadian rhythm. And OsCYP2 able to control Reactive Oxygen Species(ROS) level as a modulator through mediate the activities of antioxidant enzymes at translation level.
Expression
By the trial of qPCR,it is found that OsCYP2 expressed in various tissues, and GUS signal appeared in the root`s RAM region and lateral root`s RAM region. GUS signal appeared in the late stages of lateral root initiation, as well as both the crown and root primordia, leaves, vascular lemma(Kang et al. 2013).
OsCYP2 expression induced by salt stress and circadian rhythms.It is able to express in bud, but almost no expression in roots. In addition, OsCYP2 circadian express in Shanyou 10 is earlier than in Liangyoupei 9. Using PEG, heat damage and seedling ABA treatment can induce the OsCYP2 expression in seedling of shangyou 10.However,those treatment inhibit OsCYP2 expression in Liangyoupei 9.(Ruan et al.) 2011).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
[1]Bo Kang;Zhongchen Zhang;Lingling Wang;Libin Zheng;Weihua Mao;Meifei Li;Yunrong Wu;Ping Wu;Xiaorong Mo. OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation. The Plant Journal, 2013, 74(1): 86-97
[2]Song-Lin Ruan;Hua-Sheng Ma;Shi-Heng Wang;Ya-Ping Fu;Ya Xin;Wen-Zhen Liu;Fang Wang;Jian-Xin Tong;Shu-Zhen Wang;Hui-Zhe Chen.Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed.BMC Plant Biology, 2011, 11: 34
Structured Information
| Gene Name |
Os02g0121300 |
|---|---|
| Description |
Cyclophilin 2 |
| Version |
NM_001052252.1 GI:115443874 GeneID:4328121 |
| Length |
887 bp |
| Definition |
Oryza sativa Japonica Group Os02g0121300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:1116066..1116952 |
| Sequence Coding Region |
1116160..1116678 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:1116066..1116952 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:1116066..1116952 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctag</cdnaseq> |
| Protein Sequence |
<aaseq>MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEK GVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSP GILSMANAGPNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGGSTA KPVVIADCGQLS</aaseq> |
| Gene Sequence |
<dnaseqindica>95..613#acgcagcgatctgaagtgaaacagcaaaaaaaatcaaacaaaaagaaaaaatattccccatctgtgaaattcgcaaaaccctagcgcggcggcgatgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctagatctgtgctgttccccttcgcctttcgccagtatcagtcgtcttgagtcgtcgagtccctaaataaggaggaggtggtggtggtgttagtctttttatgagttcgtgtcgtgttggtgagatgagatcgcccatggtttggttggattaggcggagttcttggatcgattcggtggagttggatctgcgatccttcttggggttggttttaaatcttaattcgtgtcgctgcttctatgatatcgctatcaatcaatgagaacatttgggatcc</dnaseqindica> |
| External Link(s) |