Os01g0911700

From RiceWiki
Revision as of 16:21, 4 June 2014 by Houyanlin (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. During the mid- to late phase of seed development, the embryo and the aleurone tissue undergo a maturation process, whereby each becomes dormant or quiescent and acquires the ability to tolerate desiccation. The maturation process is associated with the accumulation of characteristic sets of mRNAs and proteins, which are products of the so-called LEA (Late Embryogenesis Abundant protein) genes (Baker et al. 1988, Skriver and Mundy 1990). The phytohormone ABA plays key roles in the control of these events (McCarty 1995, Leung and Giraudat 1998). Genetic loci have been identified in Arabidopsis and maize that are required for the control of maturation processes. The viviparous1 (vp1) mutant of maize has been characterized as an ABA-insensitive mutant, in which various events during seed maturation are blocked (McCarty et al. 1991, Robichaud et al. 1980). At the molecular level, the vp1 mutant fails to accumulate mRNAs of ABA-regulated LEA genes, such as Rab28 (Pla et al. 1989) and the maize homologue of the wheat Em gene (McCarty et al. 1991), as well as the genes for globulin storage proteins (Kriz et al. 1990). The Vp1 gene encodes a transcription factor that can activate the transcription of maturation-associated genes(McCarty et al. 1991, Hattori et al. 1992). In Arabidopsis, ABI3, one of the genes required for ABA response in seeds is known to be orthologous to maize VP1 (Giraudat et al. 1992). Mutant seeds with severe abi3 alleles show vivipary and block the expression of LEA and storage protein genes (Parcy et al. 1994). Parcy et al. (1994) have shown that transgenic Arabidopsis ectopically expressing ABI3 can induce expression of seed-specific genes in non-seed tissues in response to ABA. Thus, VP1/ABI3 is considered to function in determining the seed specificity of certain sets of ABA-regulated genes. Homologues of VP1/ABI3 have also been cloned from several plant species such as tobacco (Phillips and Conrad 1994), bean (Bobb et al. 1995), and wild oat Avena fauta (Jones et al. 1997). We have cloned the rice orthologue of VP1 (OSVP1) and have been studying the mechanism of tissue/organ-specific regulation of ABA-responsive genes such as the rice Em (OSEM) gene, in which OSVP1 is expected to play a key role (Hattori et al. 1994, Hattori et al. 1995). VP1/ABI3 functions as a transcription factor by acting on at least two distinct types of cis-elements, namely, ABA-response elements (ABREs) and RY/Sph elements. While VP1/ABI3 acts on ABREs via the interaction with ABRE-binding factors such as TRAB1 and ABI5 (Hobo et al. 1999a, Finkelstein and Lynch 2000, Lopez-Molina and Chua 2000, Nakamura et al. 2001), it directly binds to the RY/Sph element through its own DNA binding domain called the B3-domain (Suzuki et al. 1997).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0911700

Description

Similar to Regulatory protein viviparous-1

Version

NM_001051697.2 GI:297598172 GeneID:4324314

Length

3799 bp

Definition

Oryza sativa Japonica Group Os01g0911700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:41479033..41482831

Sequence Coding Region

41479311..41479604,41479844..41479920,41480040..41480086,41480541..41480638,41480859..41480948
,41481144..41482626,41482696..41482721

Expression

GEO Profiles:Os01g0911700

Genome Context

<gbrowseImage1> name=NC_008394:41479033..41482831 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:41479033..41482831 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgcctccgccggctcgtcggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctga</cdnaseq>

Protein Sequence

<aaseq>MDASAGSSAPAAEIRGEAARDDVFFADDTFPLLPDFPCLSSPSS STFSSSSSSNSSSAFTTAAGGGCGGEPSEPASAADGFGELADIDQLLDLASLSVPWEA EQPLFPDDVGMMIEDAMSGQPHQADDCTGDGDTKAVMEAAGGGDDAGDACMEGSDAPD DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQ NHHLQKKRPRTAIDDGAASSDPQLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTP PAAYGGDAMYPGAAGPFPFQQSCSKSSVVVSSQPFSPPTAAAAGDMHASGGGNMAWPQ QFAPFPVSSTSSYTMPSVVPPPFTAGFPGQYSGGHAMCSPRLAGVEPSSTKEARKKRM ARQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTPSSAGCRSWGIWPPAA QIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQAKTDK NLRFLLQKVLKQSDVGSLGRIVLPKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYR FWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRRAAQEQGNS SGAVGKHKHGSPEKPGVSSNTKAAGAEDGTGGDDSAEAAAAAAAGKADGGGCKGKSPH GVRRSRQEAAAAASMSQMAVSI</aaseq>

Gene Sequence

<dnaseqindica>3228..3521#2912..2988#2746..2792#2194..2291#1884..1973#206..1688#111..136#ctcagtaactgcacccacctccacacctacacgcacacagacaaacaaagccaaaccccccgcctcgcctacatctcgcgctctccgccccccgcccgcctccactctgcatggacgcctccgccggctcgtcggcgccgcactcgcacgggaacccggggaagcagggtggcggcggcggcggcggcggcggacgggggaaggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggtgtgcatgcatgcagacgattgacatcaatcgctatccaccatagctaggatctcacgcgagtgagaactcgattctcctcctcacacacactccacacactcaaaactcactcactcacatcgctgtccagggatagaatctccaatatttatcaacctagctaattaaacggcatcgattggattgctgcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagtgagacagtcaccaccatctcgaacaccttctccttccaaatccactaccccacttggcacaaatccattccatggaaggatcccacttgcacacactcacatacttgatgtttctcccctaatcaaagacggaatttgcctgaaccttctcttcacatttccgatcatggtagaactaaaaagtctcccctttcttgatctgtggatggtttcagaaggaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggtgagtaatcaacattcgatcgaagcatcaagcatgatttgggattgcttattaagcttgtttaagtccacttgcttctttgttaattgggaggggatagaaacctctgaaccagaaatagtaaatgactatgggatggtccctttcccaattgggcaagtgggtcatacgaacatatcattggaatctgggagtcaaataggagcatgcattcatcgtgttctatgttgatgctcaagtgcatacaacaaaaaaataaaagtgatcttttcctgctgttttcagtactaacattatgcatatgatttttgctggttctgctgagctcatgtttttgattaattaatttaattatttccattggcaatattatatatgcacaagttattcgaatacatgatggcttagattttgattcactgacattaatggatattgattttcatgaacacaggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgaatagcaaacttttgaattattcaaattttacagtcacaagccatgccaataacttccatccttaatttgtggctctcaagtattgttgattaatcgttgtcatatgttttttcaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatgtaatgttcatccatcattgcccttcccacttctttcgagtactctttaactcaactcagttggatgtgattttgagtgccaataagctatatatagttgctgcatgccactgtttgtctttaattcggatgaccagtttggcagtatctttgtttatggagtacttctgttaatttctgcaagcagcagctaattaattattaaccgtaatcttaatttatctcttaattattagcagctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctgaagaaacagatgacagcagcagcagcaagcttcagtccatttgaaggttaattattagctagctagctccgtattataaccgatggtaaaacctcctaaaaaaattaattaagttgtgcatgtgaatcgtagcgctagctagggatgatatttgatcagtaacccgtagtccccgtaccagtgacgcttaagtacgcatggtttggttgttcatcgttgaacccctgtagtgtgtcgtcgtcctgtacatgcatcgaattatggaattaattaattacc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0911700, RefSeq:Os01g0911700