Os09g0456200

From RiceWiki
Revision as of 04:03, 5 June 2014 by Huzhengrong (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsbZIP72 was an important regulator in abiotic stress response and ABA signaling transduction pathway[1]. The phytohormone abscisic acid (ABA) plays an essential role in plant adaption to drought stress.When stress was sensed by plants, the ABA level was elevated, which consequently activated the ABA response genes. A major group of transactivation factors binding to ABREs (ABA responsive elements) were basic leucine zipper proteins (bZIPs) that contained basic regions for DNA binding and leucine zipper regions for dimerization[2] [3] [4]. Yeast one hybrid experiment in this study showed that OsbZIP72 could specifically bind to ABRE element . This result indicated that OsbZIP72 could bind to the ABRE in promoters of the down stream genes and was involved in the ABA signaling pathway.

In vivo analysis of TRAB1 showed that it could transactivate the downstream reporter genes in response to ABA application[5].

Expression

The expression levels of OsbZIP72were relatively high in all tissues, and the expression levels were induced by PEG, NaCl, Cold, ABA and ACC(Guojun et al.2009). As compared among different tissues of the same genes,the expression levels of OsbZIP72 were relatively low in both root and stem(Guojun et al.2009). The expression pattern in response to environmental stresses and several hormones was also investigated. The expression levels of OsbZIP72were elevated by MeJA and NAA treatment, while, repressed by pathogen treatment(Guojun et al.2009). The enhancement of drought tolerance by overexpression of several group A AtbZIPs has been reported (Kang et al. 2002; Oh et al.2005).OsbZIP72is the first positive regulator identified in this group for rice drought tolerance. Transgenic rice plants overexpressing OsbZIP72 were hypersensitive to ABA and had elevated expression of the ABA responsive genes.

Evolution

In order to better understand the relationships within the group A bZIPs of rice and Arabidopsis, the entire protein sequences of this group from rice and Arabidopsis were aligned and a bootstrap NJ-tree was constructed using ClustalX (Thompson et al. 1997) (Fig.1). According to this phylogenetic tree, all of the bZIPs could be classified into three subgroups. Each subgroup contains both rice and Arabidopsis bZIPs, indicating that the divergence of these subgroups predated the divergence of dicots and monocots. It also indicated that the protein sequences of these bZIPs were well conserved between dicots and monocots(Guojun et al.2009).


Tu.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0456200

Description

Similar to BZIP transcription factor ABI5

Version

NM_001069897.1 GI:115479536 GeneID:4347257

Length

3914 bp

Definition

Oryza sativa Japonica Group Os09g0456200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:17843808..17847721

Sequence Coding Region

17843880..17844830,17845124..17845195,17846037..17846066,17847106..17847183

Expression

GEO Profiles:Os09g0456200

Genome Context

<gbrowseImage1> name=NC_008402:17843808..17847721 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:17843808..17847721 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggcagatatcatggaaatgcagaaaaatgaggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtga</cdnaseq>

Protein Sequence

<aaseq>MLTDRWGGRREAMEFGNGGSSSSERRAAAEGATLARQGSVYSLT FDEFQSALAGGGGGGGGGSGFGKDFGSMNMDELLRSIWTAEESQAMASASGSAAGVGV AVGAPPTSLQRQGSLTLPRTLSAKTVDEVWRNLVRDEPPPVGAADGGDMPPQRQSTLG EMTLEEFLVRAGVVRENPPAAPPPVPPPMPPRPVPVVPKTTAFLGNFPGANDAGAAAL GFAPLGMGDPALGNGLMPRAVPVGLPGAAVAMQTAVNQFDSGDKGNSDLSSPTEPMPY SFEGLVRGRRNGGGVEKVVERRQRRMIKNRESAARSRARKQAYTLELEAEVQKLKEMN KELERKQADIMEMQKNEVEEMIKDPFGRRKRLCLRRTLTGPW</aaseq>

Gene Sequence

<dnaseqindica>73..1023#1317..1388#2230..2259#3299..3376#gactcgtggcgatcctgagcttctttgggcgtcgaattcctgtggtgcgcggccggcgtggtgcgttgcttgatgctgacggataggtggggagggaggagggaggcgatggagttcgggaacggcgggtcctcctcgtcggagcgcagggcggcggcggagggggcgacgctggcgagacagggttcggtgtattcgctgacgttcgacgagttccagagcgcgctcgctggtggcggcggcggcggcggtggtggaagcgggttcgggaaggacttcggctccatgaacatggacgagctgctccggagcatctggaccgcggaggagagccaggccatggcctccgcctctggctccgccgcgggggtgggcgtggccgtgggggcgccgccgacgtcgctgcagcgccagggctcgctcaccctgccccgcacgctcagcgccaagacggtggacgaggtatggcgcaaccttgtgcgcgacgagccaccgccggtgggggcggcggatggcggcgatatgccaccccagcggcagtcgaccctcggggagatgaccctggaggagttcttggtcagagccggcgtggtccgagaaaatccacccgctgcgccgccccccgttcccccgccaatgccgccgcggccagtcccggtggtccccaagaccactgccttcttgggaaacttccccggtgccaacgatgccggcgcggcggcgctgggctttgcgccgctcggcatgggggatccagccttgggcaatggcctgatgcccagggcagtgccagtgggcttgcctggcgccgccgtcgctatgcaaacagcggtgaaccagtttgattctggcgataaggggaacagcgacctgtcatcgccgacggagccaatgccttattccttcgaagggttggtgagggggagaaggaacggtggcggagtagagaaagtggtggagaggaggcagaggaggatgatcaagaacagggagtccgcggcgagatcccgcgcgcgcaagcaggtcttaaactctaaattctttgtactgattatgcatctattgctattggaaccattctgtgagagtgccaagttgttgagcctacctcaaaataagatgatagaaatactattggcagtaacttagtttactggagtttcccatggcatgctaatcttagcaactataatcaaactttgtgttatatgagcagagctgttggctagtttgttcatccctgttatggattttgtttaaaagcagataatttcatcaaatttcctgtcttgctaacaatttccttattggaaaaggcttacacattggaattggaagctgaagttcagaaactcaaggagatgaacaaggaattggagaggaaacaggtttctttctgacaaactctgttgtagaatgttgaatggactattagcacatgattaattaagttttaattattacaaacttgacaaatggatatatttgatattttaaaataacttctatatagaaagttttcccacgaaacacaccgtttagcggtttgaaaagcgtgctaacggaaactgaggtaaaatttgtatagtctcctttcagtataaagaacaaggcctacttttagtatagtctccttaagaaggatttatactgctgttctaaaactcgtagcttcagttcttaaaccccagtattagctgctttgcttctctgttcatgttcatgacatcagagggttcaaacagggttcactatgacttgctctttcgaagtaatgcatatgtttctcagaaacaaagcccattgtgtccaacattgagtttctcttttagaataatcttccaatgttgctgcagtaatagtttcaattccttgtctaggaagaaaatttttttcatatctgacatgatgccaacagccctgttgcctacgtacacaaaacgcatattacccagcttgcacttcttataaatgattggtgaacatgtcggtaaattagggctcaagtatcatacttgaagtttatcatttttatagactttttttttattccagtctatgcggaaagcatgcaatcaaccatctattattacaaaattttagggctttatccataggctaccgaccaatgctagcaaatagcactcgtttacagaattcaaagtttggatatgctcatagcgtactcctttgagagtcctgatattttctttttcttccatcttgcaggcagatatcatggaaatgcagaaaaatgaggtaattgctttcgtcgtttgtttatgtcaaatgtgtgcccttgacacttttctctgtttttacagttacaactataataaatgtcaagataacgctatgtgctgtctgcttaattttttactatgtttttagcttaatttcatttcactttctgttgttcgcataatttagtctgaggttggaatgctggatgtgcatttgtgggacaaatgcttcaatacttacaagttacaacacaaatatttcgcacatgtaaactttgcattctctttcaggttattgcctacagatgctatcttccagttcgtttgttgaattgttgtccattctttttgtttcaaaacatttatttttaggtgttatgcttcttgtattcattacatgaagaaaaatctaggtcatttgctgctttcagttaaaacccttgcttctcattgtatgcacaagtatttttacatgctagcttattcgtgttctcattttctcattagtagactactttttatctcgtgtgtttttcatggcactatatgatggattttttttgacataatatatgatggaatttttattaattcttctttctctaatcaaaccatctcatattaatttggtaatttgtggaatccagtcctttttccttattttggtgtggattgtgctcatttctaagaacagagtagttgtgtagctgcagaatttctttatttctggtatatttacatatggttagctaaatttcatgaaaaacattttctgattttcagtactctctgaaaactactattatggtacaatgttatttgcagtttttctcgagccaatatctcccaagaactggagaaaaaattacttagtgattagcattattatccaaatcatagggttttgagcgtcgactcttgcaaaattcaacttccagtaccataccatttcattcagtattcagcgaacctgcttgtcagaaaaaaagtgtggaacgggtattttatcgtattttacctgtgtaactgcttaaattttgtttcactgcttataggtagaagaaatgataaaggatccatttggaagaaggaagagactttgcttgcgaagaacactgactggtccctggtgatgacgagtggtcgatggcatgcaaattcccaccttcatcagcgactgtgcataatttaatctgttgtaaaccaatggtggacgaacttgtgcttgattaatcttctagtttcatttttcctgctagctgattctgagaaggcttccaaaactgacatgtagattatgtgtagacgaatgaagctgtcagaacaacttcctgtaatccttgagaaaacttgtatagtgttgtctaggtttgtatcatgctagtctttctatctagtgtcccaccctagagaccagacatcttggatgagttcagaggtcgatttaagcaagtcatggggaccaagaatcatactgcaacctgcctgatgactagctaagctaggtagtatgtagcaatatctgatatctgtacctgcttcctgaagtatgtattgttatctagtgtatctgatatctagcgtgtaaactgtaaaggagtataagcagacctagttctcaagaaaaaaaagtataagcagacctactaattgcttataagcctgttactt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0456200, RefSeq:Os09g0456200