Os06g0181700
Please input one-sentence summary here.
Contents
Annotated Information
Function
ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.
The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.
To investigate the functional role of this region,Youhua Wang fused the coding regions of OsWR1 and its deletion of the predicted acidic activation region to the DNA-binding-domain expres- sion vector of GAL4 and examined the behavior of GAL4– OsWR1 and GAL4–OsWR1–DAD constructs as potential transcriptional activators in yeast. In the presence of the activation domain, the OsWR1 protein fused to the DNA- binding domain activated transcription of the lacZ reporter gene, whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may act as a transcriptional activator.
Expression
To test this possibility, an in vivo targeting experiment by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells, and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
References
Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice Plant Molecular Biology, 2012, 78(3): 275-288
Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004) The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480
Labs working on this gene
Please input related labs here.
Structured Information
| Gene Name |
Os06g0181700 |
|---|---|
| Description |
Pathogenesis-related transcriptional factor and ERF domain containing protein |
| Version |
NM_001063516.1 GI:115466763 GeneID:4340313 |
| Length |
980 bp |
| Definition |
Oryza sativa Japonica Group Os06g0181700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:4039785..4040764 |
| Sequence Coding Region |
4039909..4039991,4040099..4040552 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:4039785..4040764 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:4039785..4040764 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC</aaseq> |
| Gene Sequence |
<dnaseqindica>125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc</dnaseqindica> |
| External Link(s) |