Os04g0178400

From RiceWiki
Revision as of 07:15, 5 June 2014 by Wuyingga19910313 (talk | contribs) (Mutaotion)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  File:The function of CYP99A3.jpgThe rice genome contains a biosynthetic gene cluster for momilactone production, located on rice chromosome 4, which contains two cytochrome P450 (CYP) mono-oxygenases, CYP99A2 and CYP99A3. More specifically, CYP99A3 catalyzes consecutive oxidations of the C19 methyl group of the momilactone precursor syn-pimara-7,15-diene to form, sequentially, syn-pimaradien-19-ol, syn-pimaradien-19-al, and syn-pimaradien-19-oic acid, which are presumably intermediates in momilactone biosynthesis, as a C19 carboxylic acid moiety is required for formation of the core 19,6-clactone ring structure. In addition, CYP99A3 also oxidized syn-stemod-13(17)-ene at C19 to produce, sequentially, syn-stemoden-19-ol, syn-stemoden-19-al, and synstemoden-19-oic acid, albeit with lower catalytic efficiency than with syn-pimaradiene. The corresponding full length of the CYP99A3clones can be obtained from the rice cDNA database[1].

Expression

Please input expression information here.

    Rice plants (O. sativa L. ssp. Nipponbare) were cultivated in growth chambers under 12 h light and 12 h dark cycles to the sixth leaf stage, and CYP99A3’s metabolite analysis was carried out for each time point (and the control) using approximately 2 g rice plant leaf tissue.
    Recombinant baculoviruses were constructed starting from pDEST8 constructs, and used to express CYP99A2 and CYP99A3 in Sf21 insect cells. Microsomes or lysates were isolated from these recombinant cell cultures and used for in vitro assays.After incubation at 28℃ for 6 h, the reaction mixture was extracted three times with an equal volume of ethyl acetate. The organic extract was dried under a gentle stream of N2 gas, and dissolved in hexane for GC-MS analysis.CYP99A2 and CYP99A3 were recombinantly expressed in E. Coli using modular diterpene metabolic engineering system . Specifically, we co-expressed these CYPs from the OsCPR1 co-expression constructs , with a GGPP synthase and CPS carried on co-compatiblepGGxC vectors, and OsKSL expressed from the additionally co-compatible pDEST14 or pDEST15 (i.e. for expression as a fusion to glutathione-S-transferase, GST).Enzymatic products were extracted from 50 ml cultures with an equal volume of hexane, then ethyl acetate, and the pooled, concentrated, and the methylated extract analyzed by GC-MS . In every case, the expected diterpene olefin product (i.e. given the co-expressed diterpene synthases) was easily observed, indicating that all potential substrates were present at sufficient levels for further transformation (i.e. by CYP99A2 or CYP99A3).
    CYP99A3 gene-specific primers (forward: 5'-GAGCCTCCTCGTCTCGGA-3'; reverse: 5'-AATTGCCTTGACGTGTGTTGA-3').

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

   The CYP99A2 and CYP99A3 cDNAs are 1780 and 1750 bp in length with ORFs encoding 502 and 507 amino acid residues, respectively, and the CYP99A2 and CYP99A3 amino acid sequences are 83.9% identical, and no other P-450 ORFs with greater than 40% identity to these ORFs are present in the rice genome.The amino acid sequences encoded by CYP99A3 and CYP99A1 share 55.0%  identity.

Mutation

Please input mutation information here.

  Because of the 87% identity at the nucleotide sequence level(83.9% identity at the amino acid sequence level) between CYP99A2 and CYP99A3, RNAi-mediated knockdown of either     CYP99A2 or CYP99A3 resulted in production of the double knockdown of the two genes.The RNAi knockdown of CYP99A2 consisted of a region of 108-bp 3’-UTR and a 217-bp 3’’-terminal region of the ORF, which is highly homologous to that of CYP99A3.The RNAi-mediated knockdown of CYP99A3 consisted of an 81-bp 3’-UTR and a 207-bp 3’-terminal region of the CYP99A3 ORF, resulting in production of the double knockdown lines.
 In the CYP99A2/CYP99A3 double-knockdown lines, momilactone biosynthesis was specifically suppressed, but the total amounts of phytocassanes in the double knockdown are similar to those in the control, so CYP99A2, CYP99A3 or both are involved in the biosynthetic steps between 9ˇH-pimara-7,15-diene and 3ˇ- hydroxy-9ˇH-pimara-7,15-dien-19,6ˇ-olide in the momilactone biosynthetic pathway.

Extension knowledge

Please input Extension knowledge information here.

  In two independent OsDCL3a RNAi lines,Ithe transcript levels of CYP99A3 increased with decreasing accumulation of 24-nt siRNAs from MITEs(miniature inverted repeat transposable elements) in the 5’ or intron regions of the corresponding genes, indicating that an OsDCL3a deficiency and loss of 24-nt siRNAs causes the up-regulation of genes critical for diterpenoid biosynthesis, which may influence GA biogenesis and therefore reduce plant height.
  In rice, there is a 168-kb gene cluster on chromosome 4 that consists of a possible dehydrogenase gene (AK103462), P-450 genes (CYP99A2 and CYP99A3), and two diterpene cyclase genes (OsCyc1 and OsKS4) involved in momilactone biosynthesis . AK103462, CYP99A2, and CYP99A3, together with OsCyc1 and OsKS4, form a chitin oligosaccharide elicitor- and UV irradiation-inducible gene cluster on chromosome 4 and they are involved in phytoalexin biosynthesis.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0178400

Description

Similar to Cytochrome P450 CYP99A1 (EC 1.14.-.-) (Fragment)

Version

NM_001058707.1 GI:115457143 GeneID:4335091

Length

2112 bp

Definition

Oryza sativa Japonica Group Os04g0178400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:5324744..5326855

Sequence Coding Region

5324944..5325573,5325907..5326785

Expression

GEO Profiles:Os04g0178400

Genome Context

<gbrowseImage1> name=NC_008397:5324744..5326855 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:5324744..5326855 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatggagataaactcagaagccaccgtcaccctcgtctccgtcgtcaccctgcccattcttctcgcgttgctgacccgcaagtcgtcgtcaaagaagagacggcctccggggccatggaacctccccttggtcggcggcctcctccacctcctccggtcgcaaccgcaggtcgcactccgcgacctcgccggcaagtacggcccggtgatgttcctgcggacggggcaggtggacaccgtcgtgatctcctcgccggcggcggcgcaggaggtgctccgcgacaaggacgtcaccttcgcgtcgcggccgagcctcctcgtctcggagatcttctgctacggcaacctcgacatcggcttcgcgccctacggcgcctactggcggatgctgcgcaagctctgcacggtggagctcctcagcaccaagatggtgcggcagctcgcgccgatcagggacggcgagacgctggcccttgtcaggaacatcgaggccgccgccggcggcaagaagccgttcaccctcgccacgctgctcatctcgtgcacgaacacgttcaccgcgaaggcggcgttcgggcaggcgtgcggcggcgagctccaggagcagttcttgacggctctggacgaagcgctcaagttcagcaatgggttctgcttcggcgacctcttcccgtcgctgcggttcatcgacgccatgaccgggctgaggagccgcctggagcgactgcgcttgcagctggacaccgtcttcgacaagatcgtcgctcagtgcgagtcgaatccgggtgattcccttgtcaacgtcctgctcaggatcaaggaccagggcgagcttgacttcccctttagctcaacacacgtcaaggcaattatactggatatgttcacgggagggacagagacgacatcatctaccaccgagtggctcatgtcggagttgatgaggaacccagaggtgatggccaaggtgcaggctgaggtgcgaggagtattcgacaacaagagcccacaagaccacgagggcctgcttgaaaacctatcatacatgaagttggtgatcaaggagaccctgaggctgaatccggtgttgccgctgctactcccccatttatgtcgggagacctgcgaaatcggagggtatgagattgtggagggcaccagagtgttgatcaattcgtgggcgatggcgaggagccccgagtattgggacgatgcggagaagttcataccagagaggtttgaggatggcacagcggacttcaaaggctcccgttttgagtacttgccatttgggaccgggagaaggaggtgccctggtgatatatttgcaatggccacgctggaactcatcgtggcgcgccttctatactacttcgactggagcctcccggatgggatgcagccaggtgatatcgacatggagctcgtcgttggtgcaacggcgaggagaaagaatcatctccagctagtggcatcaccatataagccgatttccatgcaaagttga</cdnaseq>

Protein Sequence

<aaseq>MMEINSEATVTLVSVVTLPILLALLTRKSSSKKRRPPGPWNLPL VGGLLHLLRSQPQVALRDLAGKYGPVMFLRTGQVDTVVISSPAAAQEVLRDKDVTFAS RPSLLVSEIFCYGNLDIGFAPYGAYWRMLRKLCTVELLSTKMVRQLAPIRDGETLALV RNIEAAAGGKKPFTLATLLISCTNTFTAKAAFGQACGGELQEQFLTALDEALKFSNGF CFGDLFPSLRFIDAMTGLRSRLERLRLQLDTVFDKIVAQCESNPGDSLVNVLLRIKDQ GELDFPFSSTHVKAIILDMFTGGTETTSSTTEWLMSELMRNPEVMAKVQAEVRGVFDN KSPQDHEGLLENLSYMKLVIKETLRLNPVLPLLLPHLCRETCEIGGYEIVEGTRVLIN SWAMARSPEYWDDAEKFIPERFEDGTADFKGSRFEYLPFGTGRRRCPGDIFAMATLEL IVARLLYYFDWSLPDGMQPGDIDMELVVGATARRKNHLQLVASPYKPISMQS</aaseq>

Gene Sequence

<dnaseqindica>1283..1912#71..949#aagctaaactgccaagtaattaaacctaatcaatcatcaagccatatatacatcctctatctatcgatcgatgatggagataaactcagaagccaccgtcaccctcgtctccgtcgtcaccctgcccattcttctcgcgttgctgacccgcaagtcgtcgtcaaagaagagacggcctccggggccatggaacctccccttggtcggcggcctcctccacctcctccggtcgcaaccgcaggtcgcactccgcgacctcgccggcaagtacggcccggtgatgttcctgcggacggggcaggtggacaccgtcgtgatctcctcgccggcggcggcgcaggaggtgctccgcgacaaggacgtcaccttcgcgtcgcggccgagcctcctcgtctcggagatcttctgctacggcaacctcgacatcggcttcgcgccctacggcgcctactggcggatgctgcgcaagctctgcacggtggagctcctcagcaccaagatggtgcggcagctcgcgccgatcagggacggcgagacgctggcccttgtcaggaacatcgaggccgccgccggcggcaagaagccgttcaccctcgccacgctgctcatctcgtgcacgaacacgttcaccgcgaaggcggcgttcgggcaggcgtgcggcggcgagctccaggagcagttcttgacggctctggacgaagcgctcaagttcagcaatgggttctgcttcggcgacctcttcccgtcgctgcggttcatcgacgccatgaccgggctgaggagccgcctggagcgactgcgcttgcagctggacaccgtcttcgacaagatcgtcgctcagtgcgagtcgaatccgggtgattcccttgtcaacgtcctgctcaggatcaaggaccagggcgagcttgacttcccctttagctcaacacacgtcaaggcaattatactggtaataatttcatttatttactgctgaaaaatatatactccctccatcataaaatataagcatttttagaatagtgacaagtcaagcatttataactttgactattaatagcaaaaaaataaaaaagaccaatcgtgttactagatttatcactaaacaaaatattataacatgcaactctttttatttaaaacatcttacttttataaaaattattggtcaaagtagtatctcaaagaccgtgtcagcgtctaaaaatgcttatattttgggacggagggagtatatgtttcttcaatcttcattcttgctcatgtagttggtttcattcaggatatgttcacgggagggacagagacgacatcatctaccaccgagtggctcatgtcggagttgatgaggaacccagaggtgatggccaaggtgcaggctgaggtgcgaggagtattcgacaacaagagcccacaagaccacgagggcctgcttgaaaacctatcatacatgaagttggtgatcaaggagaccctgaggctgaatccggtgttgccgctgctactcccccatttatgtcgggagacctgcgaaatcggagggtatgagattgtggagggcaccagagtgttgatcaattcgtgggcgatggcgaggagccccgagtattgggacgatgcggagaagttcataccagagaggtttgaggatggcacagcggacttcaaaggctcccgttttgagtacttgccatttgggaccgggagaaggaggtgccctggtgatatatttgcaatggccacgctggaactcatcgtggcgcgccttctatactacttcgactggagcctcccggatgggatgcagccaggtgatatcgacatggagctcgtcgttggtgcaacggcgaggagaaagaatcatctccagctagtggcatcaccatataagccgatttccatgcaaagttgatggatgtgtgtgactgtgtgtcggtgtacttgcggttcgcttacgtgcttgcatacctcttaataagttttgtttgtcctggggaaatggacaaacaaattaataatactagttgataccccgtgctttgccgtgggatgtgtggatgaatgcattttatatatgatataaatgatagatgtacaagtttaaataatgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0178400, RefSeq:Os04g0178400