Os05g0108800

From RiceWiki
Jump to: navigation, search

Os05g0108800 encodes the protein Cytochrome b5.

Annotated Information

The sequence of Os05g0108800is same to Cb5 in tobacco, which encodes cytochrome b5.

Function

cytochrome b5 is a small haem protein associated with the endoplasmic reticulum of higher plants, animals and fungi[1]
. The role of cytochrome b5 in plants is involving in the desaturation of acyl-complex lipids in oilseeds[2]
. A full-length clone encoding cytochrome b5 has been isolated from a tobacco leaf cDNA library in lambda gt11 by PCR using degenerate primers. Southern analysis indicated that more than one gene encodes cytochrome b5 in the tobacco genome. In vitro transcription and translation studies of the cDNA indicated that the protein inserts into the ER membrane by a non-SRP-mediated pathway and that the C-terminus of the protein is required for targeting and insertion[3]
.

Expression

In the developing tobacco seed the mRNA is abundant at very early stages (< 10 days after flowering).[3]

File:640px-1jex cyto b5.png(file)

Evolution

This cDNA encodes a protein of 139 residues which exhibits a high degree of homology to other cytochrome b5s, the message for which is expressed predominantly in developing seeds and in pigmented flower tissue. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1]Ozols J: Structure of cytochromeb 5 and its topology in the microsomal membrane. Biochim Biophys Acta 997 121–130 (1989). [2]Rich PR, Bendall DS: Cytochrome components of plant microsomes. Eur J Biochem 55: 333–341 (1975). [3]Kearns EV, Hugly S, Somerville CR: The role of cytochromeb 5 in Δ12 desaturation of oleic acid by microsomes of safflower (Carthamus tinctorius L.). Arch Biochem Biophys 284: 431–436 (1991). [4]Smith MA, Cross AR, Jones OTG, Griffiths WT, Stymne S, Stobart AK: Electron transport components of the 1-acyl-2-oleoyl-sn-glycero-3-phosphocholine 537–1 (Δ12-desaturase) in microsomal preparations from developing safflower (Carthamus tinctorius L.) cotyledons. Biochem J 272: 23–29 (1990). [5]Mark A. Smith, A. Keith Stobart, Peter R. Shewry, Johnathan A. Napier:Tobacco cytochromeb 5: cDNA isolation, expression analysis andin vitro protein targeting. Plant Molecular Biology: 527-537(1994)

Structured Information

Gene Name

Os05g0108800

Description

Cytochrome b5

Version

NM_001060969.1 GI:115461668 GeneID:4337583

Length

1812 bp

Definition

Oryza sativa Japonica Group Os05g0108800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:470434..472245

Sequence Coding Region

470569..470658,471609..471675,471795..472051

Expression

GEO Profiles:Os05g0108800

Genome Context

<gbrowseImage1> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:470434..472245 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttag</cdnaseq>

Protein Sequence

<aaseq>MSNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGG DDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQ DKTPEFIIKILQFLVPLAILGLAVAIRIYTKSESA</aaseq>

Gene Sequence

<dnaseqindica>136..225#1176..1242#1362..1618#atccccacgagacgagaaacctagcaaaaatctcgtctttcgccgcgctctccctcctctgattcctgctgttcttgatcttggatctcaattcccaaccaagaacacacagacagagaaaggaaggagaagaagatgtcgaacgacaacaagaaggtgtataccctggaggaggtcgccaagcacaactccaaggacgactgctggctcatcatcggcggaaaggtctcatcttttgtttttcttttcttttcacgcttttacttacttgtactattcgatttcatgtttcgattcgtttcgttggttcttggttccctatcctccaacaacgtcctgagacctcgatctggtcggagtccacgaccagatcttggccgcggcgcagatctggccctccagccgccggcgtggggaccttgccagatctggtcttctccgacggtggccaacttctcttgtcccttggttgcagccaccaaacctcttcctcccctcctcgatccaaccttggtcttgttcatcgactggccactaaaccccaaataagcgagatagaatttggattcgtttcgttggttattgtttctctgatgctgtgatggtggctagatcatggcagatctgcccagtaaagtcgaattttgtttgattccaccgcacctcctgaggaatcggtccaatcctgtgaattcttctcttctttcctgctgattggattgtctacatgggctttacctggaaacaggggtgagtgctagcagattcaaacatcatggactgactgctcctaaacaagttccatatgaaaacctgttctacatgctttttttcttttactcttcactcgttgtcagtcaaacactgcaaaatttgtccctgcgcctattctgcaagagcttcttgttagtacaactgaagaatcaatcctctgttccaacttggcatctggacagaataatgaatgtttcataggaaaggctcagctcaactaagtaaatcatgttgattggccttaaaacacacttcattaagagtctgttttttttatattggacatgataagaataatatggctgttttttattattaatgttttttcttggtaacagtgcttctattgatgaacctaccctgtttacctgatctcaccagtgttctgcaatactatccaggtatacaatgtgtcgaaattccttgaggaccatccaggaggtgatgatgtcttgctatcttcaactggtacgccttctcaattctcatgttctggccttctgagtagtgaccactactgatgaattaactgagtttgcaatggatggtttagcttacactttgaaatatacatggaccttctgcaggcaaggacgcgactgacgattttgaggatgtcgggcacagcacgactgctcgtgcgatgatggatgagtattacgttggcgacatcgacacatccacaatacccgcgaggacgaagtacgttcccccaaagcaaccacactacaaccaggacaagaccccggagttcatcatcaagatcctccagttcttggttcccctcgccatattgggcctggctgttgcaattaggatctacaccaagtcggagtccgcttagtgctgttctcttagtgttataagagtggaaggtaccgaataagttagcaagagttttgtgtgattcataccagtgtaacatgtcatgaattcgtcgaatgttctgaagatgctgtgggttttgtggtcctgggatgtccacttcggtaaagatcgataagattcaaagtactcgttaatcgttatacattctga</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0108800, RefSeq:Os05g0108800

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1.262
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref3.264
  3. 3.0 3.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref5