Os05g0322900

From RiceWiki
Revision as of 11:16, 9 June 2014 by EmmaJune (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

OsWRKY45 is a member of the WRKY transcription factor family. The WRKY transcription factors in plant play important roles and act wildly in response to varies biotic and antibiotic stresses.

Function

A number of WRKY-type transcription factors from different plant species have been identified to play important roles in host-pathogen interactions. These WKRYs function either as positive or negative regulators in defense responses. Some WRKYs are both positive and negative regulators in different defense responses. Some other WRKYs have partly redundant functions in defense signaling.[1]

OsWRKY45, according to the rice genome annotation of The Institute for Genomic Research(http://rice.tigr.org) functioned downstream of OsWRKY13. Activation of OsWRKY13 repressed OsWRKY45 expression, and suppression of OsWRKY13 enhanced OsWRKY45 expression; furthermore, Xanthomonas oryzae pv oryzae(Xoo) infection influenced OsWRKY45 expression. These suggest that OsWRKY45 may be involved in rice-Xoo interactions.[1]

In addition, one study shows that OsWRKY45 transcription factor plays a crucial role in benzothiadiazole-inducible blast resistance. The RNA interference-mediated knockdown of OsWRKY45 compromised BTH-inducible resistance to blast disease, indicating that it is essential for BTH-induced defense responses.[2] another study shows that overexpressing OsWRKY45 in Arabidopsis enhanced resistance to the bacterial pathogen Pseudomonas syringae tomato and enhanced tolerance to salt and drought stresses and this gene may be involved in the signal pathways of both biotic and abiotic stress response. [3]

There are two alleles of OsWRKY45 functioned differently in rice-pathogen interactions. The allele[2] from japonica rice var Nipponbare is called OsWRKY45-1 and the alleles from indica rice var Minghui63 is called OsWRKY45-2. This pair of allelic genes encode proteins with a 10-amino acid difference, play opposite roles in rice (oryza sativa) resistance against bacterial pathogens. OsWRKY45-1-overexpressing plants showed increased susceptibility and OsWRKY45-1-knockout plants showed enhanced resistance to Xoo. OsWRKY45-2-overexpressing plants showed enhanced resistance and OsWRKY45-2-suppressing plants showed increased susceptibility to Xoo. Both OsWRKY45-1- and OsWRKY45-2 expressing plants showed enhanced resistance to M.grisea. OsWRKY45-1-regulated Xoo resistance was accompanied by increased accumulation of salicylic acid and jasmonic acid and induced expression of a subset of defense-responsive genes, while OsWRKY45-2-regulated Xoo resistance was accompanied by increased accumulation of jasmonic acid but not salicylic acid and induced expression of another subset of defense-responsive genes. These results suggest that both OsWRKY45-1and OsWRKY45-2 are positive regulators in rive resistance against M. grisea, but the former is a negative regulator and the latter is a positive regulator in rice resistance against Xoo . The opposite roles of the two allelic genes in rice-Xoo interaction appear to be due to their mediation of different defense signaling pathways.[1]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<ref name="ref1">

<ref name="ref2">

<ref name="ref3">

<ref name="ref4">

Structured Information

Gene Name

Os05g0322900

Description

Similar to WRKY transcription factor 45

Version

NM_001061727.1 GI:115463184 GeneID:4338413

Length

2144 bp

Definition

Oryza sativa Japonica Group Os05g0322900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:14969394..14971537

Sequence Coding Region

14969506..14969813,14970407..14970511,14970613..14971180

Expression

GEO Profiles:Os05g0322900

Genome Context

<gbrowseImage1> name=NC_008398:14969394..14971537 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:14969394..14971537 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaaggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttga</cdnaseq>

Protein Sequence

<aaseq>MTSSMSPAPAPAYAQVMEDMEKGKELAAQLQGLLRDSPEAGRFV DQILHTFSRAMRALDKAAVSAAGGEGSEVQSEVTCGGGASAGGKRKAPAADRKANCRR RTQQSSGNSVVVKNLDDGQAWRKYGQKEIQNSKHPKAYFRCTHKYDQLCTAQRQVQRC DDDPASYRVTYIGEHTCRDPATAPIIAAHVIHQVAAGDNDDGCGGLQAGSRLISFVAA PAAPVDAAAAPTTSTITTVTAPGPLLQPLKVEGGVGSSDQEEVLSSLTPGSSAARGGG GGGGVAGPFGPDQGDVTSSLHWSYDAVAGMEFFKNDEVVFDLDDIMGLSF</aaseq>

Gene Sequence

<dnaseqindica>113..420#1014..1118#1220..1787#tgctttgagctccatcaccagctgagctgcgaggaagagagagtgcgagagtgcgcggcagcggcagtgtagtgtcagtcactgggtgtgcgcttgcttgcttggattgaggatgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggtgagaacgaaggccagagcatagctcatcacaaagcatagcatcatctgtgtgtaattagctgcgttctttcagggaagataggggggattgtccctcgttttccgcgcgcacgcttttcaaactactatacggtgcgtttttcgtataaattttctataggaaagttgctttaaaaaatcatattaatccatttttgaagtttcaaaatcataaaatcatgcgctaatggttcacctcgttttgcgtatattcccaatcttctctatttccttctcctcaaacacagcctgggagtgtttgagaaggggattgaggagattgggaagatacgtaaaacgaggtgagccattagctcatgattaattgagtattaactattttaaattttaaaaatagattaatatgattttttaaagcaactttcctatagaaattttttgcaaaaaacgtaccgtttaatagtttgaaaagcgtgcgcgcggaaaacgagagccaatctcccctatcacccctaaacgaacgataccttccctatcacccctaaacgaacgataccttaatgtactaagatttgtgtgtacgtattgcaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaagtgagtagacttgtcccgacaaaaaacaatgtgttcgagactgtacagttggatgcgttgcgcgctgacgaggagttgtttggggtatgctacgtgtacagggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttgatcaccgaagaatcatggatggacacgggccgggtaaaacgatcgaaagaagatggattccacgcgtgtgtacagaaataattagcggcagcgcggatcttaatttggaacttgcaaagatactcctaattagcctggctagattagtttgtaaattccttgttgatgtgtcgtctcagctttaagctgcagacatgctagcaagtaacaacacgattagtacgtagtaatgtggttcttgattatgagctgggggtcttaaccttttttgtgtgacaagcaagagaagaggatttgggtacaatgtaatcctgttcttccgctttcgaaaaaaaaaaacatatagcttcacgtgcct</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0322900, RefSeq:Os05g0322900

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3