Os01g0750100

From RiceWiki
Revision as of 09:40, 10 June 2014 by Wang xi (talk | contribs)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsWRKY13 is a gene that plays a pivotal role in disease resistance against bacterial and fungal pathogens.OsWRKY13 directly or indirectly regulates the expression of more than 500 genes that are potentially involved in different physiologic processes according to the classification of the Gene Ontology database.OsWRKY13 is also a regulator of other physiologic processes during pathogen infection. This overexpression was accompanied by the activation of salicylic acid (SA) synthesis-related genes and SA-responsive genes and the suppression of jasmonic acid (JA) synthesis-related genes and JA-responsive genes.

Expression

OsWRKY13 bound to the promoters of its own and at least three other genes in SA- and JA-dependent signaling pathways. Its DNA-binding activity was influenced by pathogen infection. These results suggest that OsWRKY13, as an activator of the SA-dependent pathway and a suppressor of JA-dependent pathways, mediates rice resistance by directly or indirectly regulating the expression of a subset of genes acting both upstream and downstream of SA and JA

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University

References

[1]The WRKY Gene Family in Rice .Christian A. Ross, Yue Liu, Qingxi J. Shen Journal of Integrative Plant Biology, 2007, 49(6): 827-842 DOI: 10.1111/j.1744-7909.2007.00504.x [2]Rice Gene Network Inferred from Expression Profiling of Plants Overexpressing OsWRKY13, a Positive Regulator of Disease Resistance.Deyun Qiu, Jun Xiao, Weibo Xie, Hongbo Liu, Xianghua Li, Lizhong Xiong, Shiping Wang .Molecular Plant, 2008, 1(3): 538-551 DOI: 10.1093/mp/ssn012. [3]Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice.Deyun Qiu; Jun Xiao; Weibo Xie; Hongtao Cheng; Xianghua Li; Shiping Wang BMC Plant Biology, 2009, 9(1): 74 DOI: 10.1186/1471-2229-9-74. [4]Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells. Zhen Xie, Zhong-Lin Zhang, Xiaolu Zou, Jie Huang, Paul Ruas, Daniel Thompson, Qingxi J. Shen Plant Physiology, 2005, 137(1): 176-189 DOI: 10.1104/pp.104.054312

Structured Information

Gene Name

Os01g0750100

Description

Similar to WRKY transcription factor-like (WRKY transcription factor 13) (WRKY13)

Version

NM_001050786.1 GI:115439942 GeneID:4324624

Length

1605 bp

Definition

Oryza sativa Japonica Group Os01g0750100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:33164978..33166582

Sequence Coding Region

33165534..33165549,33165618..33165719,33165869..33166018,33166114..33166316

Expression

GEO Profiles:Os01g0750100

Genome Context

<gbrowseImage1> name=NC_008394:33164978..33166582 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:33164978..33166582 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggccggagaggaggtgatggatcggtcgacgtcggccgaggacgggtactgcagcgccggcacggactcgccgcgggcggagtccgtcgacgagcaaggggccgccgaggagtcgtcgccccggggagggcagaagcgggagctcccctcgccgtcggcttcgccgtcgtccccgctgccacctgccgcgaagcgcagccggaggtcagtggagaagcgggtggtgtccgtgccgatcgcggagtgcggcgaccggccgaagggcgccggggaggggccgccgccgtcggactcgtgggcctggcgcaagtacggccagaagcccatcaagggctctccctacccaagggggtactacaggtgcagtagctccaaggggtgtccggcgaggaagcaggtggagcgcagccgcgccgaccccaccgtgctgctcgtcacctactccttcgacggcgccaaagcctga</cdnaseq>

Protein Sequence

<aaseq>MAAGEEVMDRSTSAEDGYCSAGTDSPRAESVDEQGAAEESSPRG GQKRELPSPSASPSSPLPPAAKRSRRSVEKRVVSVPIAECGDRPKGAGEGPPPSDSWA WRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRADPTVLLVTYSFDGAKA</aaseq>

Gene Sequence

<dnaseqindica>1034..1049#864..965#565..714#267..469#tttccatcccctccatcatgagctccaattagccgcacaccgatcccctcctcttcttcccccccttctcctctctcctctttttttcctcatccgtgcgcgatactgcgcttagtttgtgggtggggggagtgatcatcaccaaagccacaaagggggcgcggagagatattatatattctttgggaaagcgttggattagtttttctcgctttgggctttttatccggagttggagtgtgtgtgcgccgggagtggtggtggtgatggcggccggagaggaggtgatggatcggtcgacgtcggccgaggacgggtactgcagcgccggcacggactcgccgcgggcggagtccgtcgacgagcaaggggccgccgaggagtcgtcgccccggggagggcagaagcgggagctcccctcgccgtcggcttcgccgtcgtccccgctgccacctgccgcgaagcgcaggtacggataatattatggctcggtctgcgattgattaaagccctaggtaggatttagggatagaggattgattggtgtttggttggtttgagcagccggaggtcagtggagaagcgggtggtgtccgtgccgatcgcggagtgcggcgaccggccgaagggcgccggggaggggccgccgccgtcggactcgtgggcctggcgcaagtacggccagaagcccatcaagggctctccctacccaaggtaattaggctttatattcagtttggttgatattcttgagcctgttgattagttaccgtgctgattaatcactgcaattagatcagttaaacggttgttgaagtggcaagatttaatttgggtttgttgcttgtgtttattatgctcagggggtactacaggtgcagtagctccaaggggtgtccggcgaggaagcaggtggagcgcagccgcgccgaccccaccgtgctgctcgtcacctactccttcgagcacaaccacccgtggccgcagcccaagagcagcagctgccacgcgagcaagtcgtctccccggtcgacggcgccaaagcctgagccggtggctgacggacagcaccccgagccagcggagaacgaatcgtcggcgtcggcggagctggaggtaccggagccggagccggagcaggaatctgagccggttgtgaagcaggaggaggagcagaaggaggaacagaaggctgtggttgagccggcggcggtcacaaccacggtggcgccggcgccggcggtcgaggaggaggatgagaacttcgacttcggatggatcgaccagtaccacccgacgtggcaccggtcgtacgcgccgctgctgccgccggaggagtgggagcgcgagctgcaaggggacgacgcgctgttcgcggggctcggcgagctcccggagtgcgccgtcgtgttcggccgccggcgcgagctcggcctggcggccaccgcgccgtgctcctgatgatcacctcctcttttctttttcctccccttttacaatttcccttttttttttttgcttttctttagttctccttggagtaatttggattggaggttagtacatagcttgggtgatcaatgggagtgagtggcttaactgttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0750100, RefSeq:Os01g0750100