Os03g0180800
The rice gene Os03g0180800 was reported as OsTIFY11a in 2008[1], a JA signaling gene and ZIM-3 in 2013[2], OsJAZ3 in 2013[3][4], respectively.
Contents
Annotated Information
Function
- For OsTIFY11a, the PCR products were cloned into p1301H (modified based on pCAMBIA1301) which has the stress-inducible promoter of OsLEA3-I[1][5].
- JA signaling gene Os03g0180800 was up-regulated by FA exposure[2]. Overexpression of ZIM-3 (Os03g0180800), a stress-inducible gene, was found to significantly increase tolerance to salt and dehydration stresses[1][2].
Mutation
(non) over-expressed lines[1]:
- four OsTIFY11a over-expressed lines:
- H6
- H8
- H10
- H13
- four non over-expressed lines:
- H2
- H3
- H7
- H11
- the over-expression of transgenic lines showed significantly increased tolerance to the stress treatments in terms of the shoot growth.
- OsTIFY11a-overexpressed lines accumulated significantly higher content of proline than the nonover-expressed lines under the salt stress conditions.
- When the seeds of OsTIFY11a transgenic plants were germinated on MS medium containing 75 mM NaCl, the over-expressed transgenic seeds had a significantly higher germination rate than the non-overexpressed transgenic seeds, but they showed no difference in germination rate on the normal MS medium.
Expression
- The full length cDNA of OsTIFY11a for overexpression was isolated from indica rice Minghui 63 and encodes a protein with the sequence as from japonica rice. OsTIFY11a and OsTIFY11e had similar induction dynamics: the induced expression peaked at 0.5 h after JA treatment[1].
- Over-expression of OsTIFY11a, one of the stress-inducible genes, resulted in significantly increased tolerance to salt and dehydration stresses. The OsTIFY11a gene was expressed in the 3–5 cm young panicles at a relatively high level. Interestingly, almost all of the OsTIFY genes with a high expression level in leaves had a very low expression level in the stamen[1].
Subcellular localization
The transient gene expression assay using Arabidopsis mesophyll protoplasts showed that the OsTIFY11a-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the nucleus, suggesting that OsTIFY11a is a nuclear protein[1].
Evolution
- A few OsTIFY gene clusters, including two OsTIFY gene clusters (OsTIFY11a, OsTIFY11b, and OsTIFY11c; OsTIFY11g and OsTIFY10a), on chromosome 3 and one gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d) on chromosome 10[1].
- OsTIFY11a contains a TIFY domain and a Jas motif, but two amino acids (Pro and Tyr) that were identified in the Jas motif are absent in OsTIFY11a[1].
Knowledge Extension
The TIFY family is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes, such as development and responses to phytohormones, in Arabidopsis. However, there is limited information about this family in monocot species[1].
Labs working on this gene
- National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Ye H, Du H, Tang N, et al. Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice[J]. Plant molecular biology, 2009, 71(3): 291-305.
- ↑ 2.0 2.1 2.2 Chi W C, Chen Y A, Hsiung Y C, et al. Autotoxicity mechanism of Oryza sativa: transcriptome response in rice roots exposed to ferulic acid[J]. BMC genomics, 2013, 14(1): 351.
- ↑ Lee H Y, Seo J S, Cho J H, et al. Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants[J]. PloS one, 2013, 8(1): e52802.
- ↑ Shimizu T, Miyamoto K, Miyamoto K, et al. OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice[J]. Bioscience, biotechnology, and biochemistry, 2013, 77(7): 1556-1564.
- ↑ Xiao B, Huang Y, Tang N, et al. Over-expression of a LEA gene in rice improves drought resistance under the field conditions[J]. Theoretical and Applied Genetics, 2007, 115(1): 35-46.
Structured Information
| Gene Name |
Os03g0180800 |
|---|---|
| Description |
ZIM domain containing protein |
| Version |
NM_001055701.1 GI:115451130 GeneID:4331832 |
| Length |
1035 bp |
| Definition |
Oryza sativa Japonica Group Os03g0180800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:4210340..4211374 |
| Sequence Coding Region |
4210735..4211274 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:4210340..4211374 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MASTDPMTRRFAVACGVLSQYVKANSSQPSTAAPVAQGVSGLMA AAAAAAAAPVVQEPGCEVDGGGQQFTIFYAGKVVVIDRCTPAMAAELMRFASAAQGGG GAPEAPPALVDMPIARKASLKRFLAKRKATPASARSSYVVRAAAAEEEQPPAKKAKAA VERREDWLALGSLGHMHSR</aaseq> |
| Gene Sequence |
<dnaseqindica>101..640#atatgtgatcagcgacgtacagtacagatcgttcgcaataaagttagacttctcgtctctctttgtgcttgtgcttagttgtccgtgctagaagacggcaatggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctgatgatcatcgccacgacgtcacgtctgcgatttgagaattgagagctcgatcgattgatcgccatgtggtcacccggtagccgatgctgcaaggccggtcgagttggaagatggttctcgtcgcattaacggccttgagttgatttcgccgagcctgaccttgagttgattaccatggaagtatgaagatttcgtgattagcagttaccctagttatcgcggcgtataattaagcacggtcactgaagcgcaatggccttgagtcggtagatcaggactagagaggggtgtatggatctgacaagtactgtagtatattgtatcccgtttgaattttttttcgattcctatggggactgaattgattaatgatataaaattccttcgactgttctg</dnaseqindica> |
| External Link(s) |
