Os02g0726700

From RiceWiki
Revision as of 13:22, 6 June 2014 by Gaoyuhao (talk | contribs)
Jump to: navigation, search

OsbHLH133 is a regulator of iron distribution between roots and shoots in Oryza sativa.

Annotated Information

Function

OsbHLH133 was found to be induced by Fe-deficiency conditions in Oryza sativa. Insertional inactivation of OsbHLH133 (bhlh133) resulted in growth retardation, with enhanced Fe concentration seen in shoots, and reduced Fe concentration in roots. Overexpression of OsbHLH133 had the opposite effect, that is resulted in an enhanced Fe concentration in roots and reduced Fe concentration in shoots and also in xylem sap. Microarray analysis showed that some of the genes encoding Fe-related functions were up-regulated under Fe-sufficient conditions, in bhlh133 mutant plants compared to wild-type plants. Significant differential expression of a number of signalling pathways, including calcium signalling, was also seen in bhlh133 plants compared to wild-type plants, independent of Fe conditions.

1.RT-PCR analyses showed that the transcript abundance of OsbHLH133 was significantly induced by Fe deficiency in rice roots and slightly in leaves.

 Pce2569 f1.gif

2.Expression of OsbHLH133 in the root of overexpression (OE) and mutant (bhlh133) plants in Fe-sufficient (+Fe) and -deficient (−Fe) conditions. As expected, no transcripts encoding OsbHLH133 could be detected in the bhlh133 mutant plants and over 100-fold induction is seen in the OE plants. Pce2569 f2.gif

3.Growth performance of overexpression (OE) and mutant (bhlh133) plants in Fe-sufficient (+Fe) and -deficient (−Fe) conditions. Seedlings were germinated and grown on the culture solution supplied with 100 µM (+Fe) or 2 µM EDTA-Fe (II) (−Fe) for 3 weeks. (a) Growth performance and shoot length of mutant plants under Fe-sufficient (+Fe) and -deficient (−Fe) conditions. (b) Growth performance and shoot length of OE lines under Fe-sufficient (+Fe) and -deficient (−Fe) conditions. (c) SPAD value of the youngest and fully expanded leaves. Bar = 3 cm. Data shown as the mean ± SD (n = 5). Significance (P < 0.05) of differences in (longer/shorter or higher/lower) compared to WT is indicated by an asterisk. Pce2569 f3.gif

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0726700

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001054528.1 GI:115448426 GeneID:4330593

Length

1936 bp

Definition

Oryza sativa Japonica Group Os02g0726700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:31120147..31122082

Sequence Coding Region

31120423..31120583,31120671..31120848,31120955..31120993,31121072..31121167,31121247..31121314
,31121504..31121617,31121704..31122082

Expression

GEO Profiles:Os02g0726700

Genome Context

<gbrowseImage1> name=NC_008395:31120147..31122082 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:31120147..31122082 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagatccgcagatcactgaggccactggacctggccaagcagcgcggccgcagcagcggcaatggcacggcggcggggagtgccgtcgacggcgcgtcgccggcaggttcggactcggaggagcacgtgctaccgggcggcgtcgggacgttcagcatcaggcacgcgtccggtactccgtcgagagaagaggccggtagccatggcggcgtcaggaggagtgcgttcgcatttgcacctgcgcttcatggcgccaggatggagaatgcacatgaaacaggaggaagatctgggagtagggctcaccgtgcgccgtcgacgatgtggcaagattctgccattgatcaaagatccataggccagacaccatatgaagcaacaagagcagagggaagaagtagcgccagcagcgccgatcagggacccagcactccgagatcaaagcattcagcaactgagcagagaaggaggaccaagataaatgacaggcttgaaatacttcgtgaactcctgccacacactgatcagaagagagacaaagcttctttcctttcggaggttattgaatacataaggtttttgcaagagaaagtccaaaagtatgaggaagccgatccagaaaggaatcacgaggattccaaatccatgccatgggcaaaagtctactatagatcatgctggagaaacacaaagaacaccagtcaagtccagggggaagatttgtcaccatccacacaggacatgaacaacgaacagtacggtcccaagcacatatcggcagcacaacctgctctcttcaacacacagagtgtaaccagtacaaccaccagttcctcccacatggcaacaggcacaccacaaaatttggaaaagaacagcacacccagcaatcagccaccatggctgagcatgtcaacaatgcgccaagagtctgaaccaggcaacaaaatgccgaacaagcatgagaaacagacccttcacgatgaaaaccatagtatttctagcgcttactctcaagggtctgttccttaa</cdnaseq>

Protein Sequence

<aaseq>MEIRRSLRPLDLAKQRGRSSGNGTAAGSAVDGASPAGSDSEEHV LPGGVGTFSIRHASGTPSREEAGSHGGVRRSAFAFAPALHGARMENAHETGGRSGSRA HRAPSTMWQDSAIDQRSIGQTPYEATRAEGRSSASSADQGPSTPRSKHSATEQRRRTK INDRLEILRELLPHTDQKRDKASFLSEVIEYIRFLQEKVQKYEEADPERNHEDSKSMP WAKVYYRSCWRNTKNTSQVQGEDLSPSTQDMNNEQYGPKHISAAQPALFNTQSVTSTT TSSSHMATGTPQNLEKNSTPSNQPPWLSMSTMRQESEPGNKMPNKHEKQTLHDENHSI SSAYSQGSVP</aaseq>

Gene Sequence

<dnaseqindica>1500..1660#1235..1412#1090..1128#916..1011#769..836#466..579#1..379#atggagatccgcagatcactgaggccactggacctggccaagcagcgcggccgcagcagcggcaatggcacggcggcggggagtgccgtcgacggcgcgtcgccggcaggttcggactcggaggagcacgtgctaccgggcggcgtcgggacgttcagcatcaggcacgcgtccggtactccgtcgagagaagaggccggtagccatggcggcgtcaggaggagtgcgttcgcatttgcacctgcgcttcatggcgccaggatggagaatgcacatgaaacaggaggaagatctgggagtagggctcaccgtgcgccgtcgacgatgtggcaagattctgccattgatcaaagatccataggccagacaccatatgaaggttagtaccgcagttgtattgttgattctctagtctgtcacttcaattcaggcactgatggatttgatatatacatgtgcactcagcaacaagagcagagggaagaagtagcgccagcagcgccgatcagggacccagcactccgagatcaaagcattcagcaactgagcagagaaggaggaccaagataaatgacaggcaagctagtagaggtcaaacaccattttgaattattttctgcagagcaggaacaaaccaaccatgaagacgtagctagatagctcaacaagatatcatattagcagcatttaattccaagacaatttcatataagtatatggtgcaagaaatgtgttctaaaatgcaattcttcatgctctccttcaggcttgaaatacttcgtgaactcctgccacacactgatcagaagagagacaaagcttctttcctttcggaggtaaacagaatatcaattttggcactgtagtcagcaggctatattgcaatttctcccttgtgaagcattttgtttgcaggttattgaatacataaggtttttgcaagagaaagtccaaaagtatgaggaagccgatccagaaaggaatcacgaggattccaaatccatgccatgggtactatcatagccatgttagcatgttcatgacataattgtgcaacagtattcaccctctatttttttttcttggtaggcaaaagtctactatagatcatgctggagaaacacaaaggtaattccgtaaaataaaaacagcaactgaaagcgaatgcacaattcatcataatcatataccaatgatatgtacccatccttgtttcttgttcatggtctcacagaacaccagtcaagtccagggggaagatttgtcaccatccacacaggacatgaacaacgaacagtacggtcccaagcacatatcggcagcacaacctgctctcttcaacacacagagtgtaaccagtacaaccaccagttcctcccacatggcaacaggcacaccacaaaatttggaaagtaagtccatttcttatcacctttcaacagtcagaattcttgtaattaagaactagatccactaactttaatgtcttttaaacgcagagaacagcacacccagcaatcagccaccatggctgagcatgtcaacaatgcgccaagagtctgaaccaggcaacaaaatgccgaacaagcatgagaaacagacccttcacgatgaaaaccatagtatttctagcgcttactctcaagggtctgttccttaaccatttgttacttcaagactaaagttagcacaatatgtaactaacaggatactacttcaatttgcaacagattattcaacagattgacagaagctcttaaaaagtcaggactagatccatctcaagctaatatagctgtagagatcaacctggccaaacgagcaagagataatactagtgacaactcaaaggtatagagctttacaaagttgatttattcatgatgtttgaacatatagatcgtctgcttaataattattttgtacctttgtcctg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0726700, RefSeq:Os02g0726700