Os06g0625900

From RiceWiki
Revision as of 15:46, 8 June 2014 by Franky123 (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Potassium transporter 10,It's gene name is OsHAK10.Plants take up large amounts of K+ from the soil solution and distribute it to the cells of all organs, where it fulfills important physiological functions. Transport of K+from the soil solution to its final destination is mediated by channels and transporters. Rice protected young leaves from ion harm via the large accumulation of Na+ and Cl- in old leaves. The up-regulation of OsHKT1;1, OsHAK10 and OsHAK16 might contribute to accumulation of Na+ in old leaves under salt stress. A comparative kinetic analysis of HAK-mediated K+ influx in yeast and in roots of K+-starved rice seedlings demonstrated the involvement of HAK transporters in root K+ uptake.All HAK transporters may mediate K+ transport, but probably not only in the plasma membrane. Transient expression of the OsHAK10-green fluorescent protein fusion protein in living onion epidermal cells targeted this protein to the tonoplast.

Expression

QQ图片20140608232107.jpg



K+loss in the E. coli strain TKW4205 transformed with plasmid pBAD24 containing the OsHAK1-1, OsHAK7, or OsHAK10 cDNAs. Time courses of the K+ contents of cells induced in 13 mM Ara and suspended in K+-free minimal medium, pH 5.5, supplemented with 4.9% (w/v) sorbitol, and 10 mM propionic acid. Black circles, Cells transformed with pBAD24; white circles, cells transformed with OsHAK1-1; black triangles, cells transformed with OsHAK7; white triangles, cells transformed with OsHAK10



QQ图片20140608232936.jpg



Tonoplast localization of HAK10: GFP. Transient expressions in onion epidermal cells of a OsHAK10:GFP translational fusion protein was visualized by epifluorescence microscopy. A, GFP fluorescence concentrated to the tonoplast. The large vacuole of onion epidermal cells occupies most of the cell volume. B through D, Captions of different focal planes of the cell imaged in A, showing transvacuolar strands of cytoplasm (tvs). Note that the transvacuolar strands seen in C and D are lined by two tonoplast membranes. E, The tonoplast follows the cell contour except in the perinuclear region (n) where the vacuole detaches from the cell surface. F, Clear field caption of the cell shown in E depicting the perinuclear region (n). As controls, transient expression assays in onion epidermal cells of GFP and AtNHX1:GFP were carried out in parallel. G, In the control cell expressing GFP, the fluoresce concentrated in the cytoplasm and was manifestly absent in the vacuole. H, In the control cell expressing AtNHX1:GFP, the fluorescence concentrated to the tonoplast showing the perinuclear region (n). Bar = 25um. Please input expression information here.


Evolution

QQ图片20140608232126.jpg

Phylogenetic tree of rice cv Nipponbare HAK transporters and barley transporters HvHAK1 and HvHAK2. Alignments of the sequences were performed with the ClustalX program. The scale bar corresponds to a distance of 10 changes per 100 amino acid positions. Accession numbers: HvHAK1, T04379; and HvHAK2, AAF36491; You can also add sub-section(s) at will.

Labs working on this gene

(1)Department de Biotecnologı´a, Universidad Polite´cnica de Madrid, 28040 Madrid, Spain (M.A.B., B.G.,A.R.-N.); and Instituto de Recursos Naturales y Agrobiologı´a, Consejo Superior de Investigaciones Cientı´ficas, 41080 Sevilla, Spain (B.C.)

(2)Key laboratory of Molecular Epigenetics of MOE, Northeast Normal University, Changchun 130024 Jilin Province, China

References

Inventory and Functional Characterization of the HAK Potassium Transporters of Rice Marı,, a A. Bañ, uelos, Blanca Garciadeblas, Beatriz Cubero, Alonso Rodrı,, guez-Navarro Plant Physiology, 2002, 130(2): 784-795

Effects of salt stress on ion balance and nitrogen metabolism of old and young leaves in rice (Oryza sativa L.) Huan Wang; Meishan Zhang; Rui Guo; Decheng Shi; Bao Liu; Xiuyun Lin; Chunwu Yang BMC Plant Biology, 2012, 12 : 194

Structured Information

Gene Name

Os06g0625900

Description

Potassium transporter 10 (OsHAK10)

Version

NM_001064651.1 GI:115469033 GeneID:4341573

Length

4353 bp

Definition

Oryza sativa Japonica Group Os06g0625900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:26115342..26119694

Sequence Coding Region

26115342..26116097,26116211..26116617,26116746..26117000,26117099..26117222,26117336..26117388
,26117473..26117733,26118735..26118788,26118880..26119447,26119641..26119694

Expression

GEO Profiles:Os06g0625900

Genome Context

<gbrowseImage1> name=NC_008399:26115342..26119694 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:26115342..26119694 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagagcccgtctcccgtggatcctgagtcgccgagttctcccgattgcaagggagggagcagcagcaagaggaggcggctgccatggcggatgacgatgagcctggcgtaccagagcctcggggtggtgtacggcgacctgagcacgtcgccgctgtacgtgtacaaggcggcgttcgcggaggacatccagcactcggagaccaacgaggagatcctcggcgtgctctccttcgtcttctggacgctcaccctcgtcccgctcctcaagtacgtctgcgtcgtcctccgcgccgacgacaacggcgagggcggcaccttcgccctctactccctcctctgccgccacgcccgcgccgcgctcctcccgcctggcggcggcggcggcggcggcgagccgggcgacgaggaccagttcttggacgcgggcgccgacaagaaagccgcggcgaacggcaatgcgctggcgctgagcgggcgcggcggcggaggcggcgccgccgccggcgtgaggaggctgctggagcggcacaaggtgctgcagcgcgtgctcctcgtgctggcgctggtgggcacgtgcatggtcatcggcgacggcgtgctcacgccggccatctccgtgttctcggcggtatccgggctggaattgtccatggaaaagcatcagcacaaatatgtggaggttcctattgcttgttttgtactggtttgcctgttttgtctgcaacactatggtacacaccgggtggggttcctttttgcaccaattgtgattacatggcttctatgtataagcatgattggtgtttacaatatcgtgcattgggagcccaatgtctatcgagcgttatctccatattatatgtacaagtttttgaagaagacgcagagaggaggttggatgtcactgggaggaatattgttatgtatcactggttctgaagcaatgtttgcagatctggggcattttaatcagctgtcgatacagattgcttttacttgcatggtttacccatccttgatccttgcatacatggggcaagctgcttatctgtgtaagcatcacatcattgaaagtgactacaggatcgggttctatgtgtctgtgcctgagaaaattaggtggccagttctggcaattgccattcttgcagcagttgtcgggagccaagctgttatcactggcacattctcaatgatcaagcagtgcaccgctctcggctgctttcctcgggtgaagatagttcacacatctgacaaagtacacgggcaaatttacatccctgagatcaattggatcctgatgatactgtgcttagctattaccattggtttcagagacacaaaacacctgggcaatgcgtcaggattggcggttataaccgttatgctggtcacgacatgtctgatgtccctggtgatagttctgtgttggcacaagagcatcttcctcgcattcggcttcatcatcttcttcggcaccattgaggcactctacttctcagcatcactcatcaagttcagagaaggagcctgggtcccaattgtgctggccttcatcttcatggcgataatgtgcatctggcactatggcaccatcaagaagtatgagttcgatctccagaacaaggtctccatcaactggctccttggcctcagccccaacctcggcattgtccgagtccgcggcatcggcctcatccacaccgagctcgactctgggatcccggcaatcttctcgcatttcgtcaccaacctacctgcatttcatcaagtgctcatcttcctctgcatcaagaacgtcccgataccgcatgtctcgccggaggagaggttcctcgtcggaagaattggccccaaggagtacagaatctaccggtgcattgtcaggtacggctaccacgacgtgcacaaggacgatcaggagttcgagaaggagctcgtctgcagcgtcgcggagttcatccgctccggcgccgccgccgcggccgacgccgcggcctcttccaagcccaagaacgtctgcggcggcggcgcggaggagtcggagaaagaggaggaggagcggatgtccgtcatcccctccggcagcattcggatgatggaggaggacggcggcgcgggggcgccgtcgtcggaggacaccgtcggcggcagcggcagcggcagcggcagaggcagctcgcgcggcggcggcggcgcaagggagatcatgtcgccgtcgccgtcgccgccgccggtggtggtggcgccgaggaagagggtgcggttcgtgctgccggcggcgagcccgcggccggacgccggcgtgcgggaggagctgcaggagctgatggacgcgcgcgaggccggcatggcgttcatcctcggccactcctacgtcaaggccaagagcggctccagcttcttccggcggctggtcatcaacttctgctacgacttcctccgccgcaacagccgcggccccaactacgccgtcaccatccctcacgcctccaccctcgaggtcggcatgatttactatgtctaa</cdnaseq>

Protein Sequence

<aaseq>MKSPSPVDPESPSSPDCKGGSSSKRRRLPWRMTMSLAYQSLGVV YGDLSTSPLYVYKAAFAEDIQHSETNEEILGVLSFVFWTLTLVPLLKYVCVVLRADDN GEGGTFALYSLLCRHARAALLPPGGGGGGGEPGDEDQFLDAGADKKAAANGNALALSG RGGGGGAAAGVRRLLERHKVLQRVLLVLALVGTCMVIGDGVLTPAISVFSAVSGLELS MEKHQHKYVEVPIACFVLVCLFCLQHYGTHRVGFLFAPIVITWLLCISMIGVYNIVHW EPNVYRALSPYYMYKFLKKTQRGGWMSLGGILLCITGSEAMFADLGHFNQLSIQIAFT CMVYPSLILAYMGQAAYLCKHHIIESDYRIGFYVSVPEKIRWPVLAIAILAAVVGSQA VITGTFSMIKQCTALGCFPRVKIVHTSDKVHGQIYIPEINWILMILCLAITIGFRDTK HLGNASGLAVITVMLVTTCLMSLVIVLCWHKSIFLAFGFIIFFGTIEALYFSASLIKF REGAWVPIVLAFIFMAIMCIWHYGTIKKYEFDLQNKVSINWLLGLSPNLGIVRVRGIG LIHTELDSGIPAIFSHFVTNLPAFHQVLIFLCIKNVPIPHVSPEERFLVGRIGPKEYR IYRCIVRYGYHDVHKDDQEFEKELVCSVAEFIRSGAAAAADAAASSKPKNVCGGGAEE SEKEEEERMSVIPSGSIRMMEEDGGAGAPSSEDTVGGSGSGSGRGSSRGGGGAREIMS PSPSPPPVVVAPRKRVRFVLPAASPRPDAGVREELQELMDAREAGMAFILGHSYVKAK SGSSFFRRLVINFCYDFLRRNSRGPNYAVTIPHASTLEVGMIYYV</aaseq>

Gene Sequence

<dnaseqindica>3598..4353#3078..3484#2695..2949#2473..2596#2307..2359#1962..2222#907..960#248..815#1..54#atgaagagcccgtctcccgtggatcctgagtcgccgagttctcccgattgcaaggtatgggttgggtggtggaggtcgtgtcatgtttgatggttaatggtctaatcttgtcgggtttgcgagggttgtggtggtcgtgattgattgattgatcatggtgttgttgaatcttggtgcgatcttggattctttgctaatgtgtgtgtgcgcgtgtgatttgatttgggtgggtggatggatggagcagggagggagcagcagcaagaggaggcggctgccatggcggatgacgatgagcctggcgtaccagagcctcggggtggtgtacggcgacctgagcacgtcgccgctgtacgtgtacaaggcggcgttcgcggaggacatccagcactcggagaccaacgaggagatcctcggcgtgctctccttcgtcttctggacgctcaccctcgtcccgctcctcaagtacgtctgcgtcgtcctccgcgccgacgacaacggcgagggcggcaccttcgccctctactccctcctctgccgccacgcccgcgccgcgctcctcccgcctggcggcggcggcggcggcggcgagccgggcgacgaggaccagttcttggacgcgggcgccgacaagaaagccgcggcgaacggcaatgcgctggcgctgagcgggcgcggcggcggaggcggcgccgccgccggcgtgaggaggctgctggagcggcacaaggtgctgcagcgcgtgctcctcgtgctggcgctggtgggcacgtgcatggtcatcggcgacggcgtgctcacgccggccatctccggtgcgtgcgcgcccccgcttgatttgctggcttgtttgtgttcttgggttgtcgtgtgctgattttcagatggcgtgttctgtttttgcagtgttctcggcggtatccgggctggaattgtccatggaaaagcatcagcacaaatgtaaggatctgaacacccaaccatgcctttgtcccttccattgtttctgtcttttgatatgattgtagatttgtcttcctcatcttgttaactactgtttcctggatcatcatgttctgagtttttttagataattcagggtccacctcaaactcaaaagggtgcagtttcttgtttttttagttgaaaaaagtgtgcagtttcagtcatactagtgcaccacaattcgagtaaattttacctgtaagatgcacgcaagagatggattctgtgcaatttggtgttcgtaaaaccaggaattatgttaactgatgaagtctgaacagtttgcttcaatgggattgatacttttggaagtttccgtgcgagcttatcggctcagatatcagatgatcaattgcgtgccaaattcatttaggaaggtctttgacagggaatgaccatgagcaacgcagcgttgtcgcatggacaccaacaatcaactccgtactgttgttagtcaatgtatgcctaacagttgttgctataatgctattagcctacgaactggagaagattaatactcttatctagtagcattgatgactacaataaatggaactaccctactcaagcagttgtgattcttgtgaagaactgtagtgggaaacagaaagaaaagatttgagcgattcctaaataagccggtcatcatctaaattactgtatctgttcagttcatattctcttgggctttggcagaggatagagttcactctgggcagaaatatggtcagctagtggtaataaggttcggaaattctggaaaatggaagctacacatgctgaaagtaataaaataagtgctgaattctgaagtgcggagtaaagaaactctattttgacttttaatcatttaagcatgtgcttttattctgattcttgttttgctaatatgttttgtttcttttttaacccattactaactgtgcaaagttttttttactgatttgaatctgcagatgtggaggttcctattgcttgttttgtactggtttgcctgttttgtctgcaacactatggtacacaccgggtggggttcctttttgcaccaattgtgattacatggcttctatgtataagcatgattggtgtttacaatatcgtgcattgggagcccaatgtctatcgagcgttatctccatattatatgtacaagtttttgaagaagacgcagagaggaggttggatgtcactgggaggaatattgttatgtatcactggtactatgatcaacaaccattttctaccatatgccaatgatctctgaagtgtacaactttactaacttgagtgttgtttttcaggttctgaagcaatgtttgcagatctggggcattttaatcagctgtcgatacaggtgatgaaatagagtgcaatctcaatgttttgttttacttggtttcatcatagtagcaatatgcggacatgcggtcaatagttttgtctctgataagcatttcctgattgcagattgcttttacttgcatggtttacccatccttgatccttgcatacatggggcaagctgcttatctgtgtaagcatcacatcattgaaagtgactacaggatcgggttctatgtgtctgtgcctggcaagtcatgttctccagatctttcatcaacagcgaaatcgatattatatcattctcctagtactgtttattaatatttaaaagttttccatcctcagagaaaattaggtggccagttctggcaattgccattcttgcagcagttgtcgggagccaagctgttatcactggcacattctcaatgatcaagcagtgcaccgctctcggctgctttcctcgggtgaagatagttcacacatctgacaaagtacacgggcaaatttacatccctgagatcaattggatcctgatgatactgtgcttagctattaccattggtttcagagacacaaaacacctgggcaatgcgtcaggtatgtaccacttgttttagtttttgacatatcaaaccacctgattattccatgttcgaattacctatgcatactgaagctaatgagtaaggaatttgtctgatatgcaatagttgtcctttgaacaggattggcggttataaccgttatgctggtcacgacatgtctgatgtccctggtgatagttctgtgttggcacaagagcatcttcctcgcattcggcttcatcatcttcttcggcaccattgaggcactctacttctcagcatcactcatcaagttcagagaaggagcctgggtcccaattgtgctggccttcatcttcatggcgataatgtgcatctggcactatggcaccatcaagaagtatgagttcgatctccagaacaaggtctccatcaactggctccttggcctcagccccaacctcggcattgtccgagtccgcggcatcggcctcatccacaccgagctcgactctgggatcccggcaatcttctcgcatttcgtcaccaacctacctgcatttcatcaagtaatcttgctcatcagccatcattcctcgccttctgaagttgttgtcattgttcagaaattcagaattttggttacagtgctcatcatcttcttcttcttgatgatgatcaggtgctcatcttcctctgcatcaagaacgtcccgataccgcatgtctcgccggaggagaggttcctcgtcggaagaattggccccaaggagtacagaatctaccggtgcattgtcaggtacggctaccacgacgtgcacaaggacgatcaggagttcgagaaggagctcgtctgcagcgtcgcggagttcatccgctccggcgccgccgccgcggccgacgccgcggcctcttccaagcccaagaacgtctgcggcggcggcgcggaggagtcggagaaagaggaggaggagcggatgtccgtcatcccctccggcagcattcggatgatggaggaggacggcggcgcgggggcgccgtcgtcggaggacaccgtcggcggcagcggcagcggcagcggcagaggcagctcgcgcggcggcggcggcgcaagggagatcatgtcgccgtcgccgtcgccgccgccggtggtggtggcgccgaggaagagggtgcggttcgtgctgccggcggcgagcccgcggccggacgccggcgtgcgggaggagctgcaggagctgatggacgcgcgcgaggccggcatggcgttcatcctcggccactcctacgtcaaggccaagagcggctccagcttcttccggcggctggtcatcaacttctgctacgacttcctccgccgcaacagccgcggccccaactacgccgtcaccatccctcacgcctccaccctcgaggtcggcatgatttactatgtctaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0625900, RefSeq:Os06g0625900