Os07g0232900

From RiceWiki
Revision as of 15:28, 18 April 2013 by Xysj2012 (talk | contribs)
Jump to: navigation, search

The rice Os07g0232900 was reported as Heavy metal ATPases 3 (OsHMA3) in 2010 and 2011 four times by researchers from Japan[1][2][3][3].

Annotated Information

Function

Figure 1. Mutant VS. WT(from reference) [4].
(C and D) shows a Complementation test. Cd concentration in the shoots (C) and roots (D) of three independent transgenic lines carrying OsHMA3 and empty vector in Anjana Dhan background. (E and F) shows the Effect of decreased expression of OsHMA3 on Cd accumulation. Cd concentration in the shoots (E) and roots (F) of three independent RNAi lines and vector control plants in Nipponbare background.
Figure 2. Complementary Test of OsHMA3 in S. cerevisiae(Yeast) [2]
Figure 4. The modular structure of the OsARF family.(from reference) [3].
  • OsHAM3 encodes a P1B-type ATPase, acting as a Cd transporter, which can control the ability of root-to-shoot Cd translocation[2][3][4]. This gene is involved in the efflux of divalent metal ions across a vacuole membrane[3].
  • Defective function of OsHAM3 leads to high Cd accumulation in 3 different rice cultivars: Cho-Ko-Koku, Anjana Dhan as well as Jarjan[1][2][3][4], while the rice cultivar Nipponbare with intact function of OsHAM3 gets low accumulation rate of Cd.
  • OsHMA3 from the low Cd-accumulating cultivar limits the translocation of Cd from the roots to the above-ground tissues by selectively sequestrating Cd into the root vacuoles, thus decrease the accumulation rate of Cd in the whole plant[2][4].
  • In contrast, the allelic gene OsHMA3mc from the high Cd-accumulating cultivar lost the function to act as a firewall of Cd because of a single amino acid mutation[4].The study of this gene will be of great value for phytoremediation of Cd-polluted paddy Welds[1].

Wild Type & Mutations

Cd Accumulation Rates in different Rice plants, counted by Daisei Uenoa et al.

  • Analysis with three independent transgenic lines showed that introduction of OsHMA3 from Nipponbare into Anjana Dhan resulted in decreased Cd accumulation in the shoots (P < 0.01) (Fig 1C), but increased Cd accumulation in the roots (P<0.01) (Fig 1D)[4].
  • Furthermore, when OsHMA3 expression was knocked down in Nipponbare by RNAi, the concentration of Cd in the shoot was increased by 2.1- to 2.5-times in the RNAi lines compared with the empty-vector control plants (P < 0.05) (Fig. 1E) and the root Cd concentration was decreased by 74 to 60% in the RNAi line (P < 0.05) (Fig 1F)[4].

Complementary Test of OsHMA3 in S. cerevisiae(Yeast) by Hidenori Miyadate et al.

  • The wild-type yeast strain (BY4743) can grow, with only slight inhibition, in media containing up to 60 μM of CdCl2. The mutant strain (YDR135c), which lacks Cd transport to the vacuole, shows severe growth inhibition above 30 μM CdCl2(Fig 2)[2].
  • Expression of OsHMA3 in the mutant yeast strain increased its Cd tolerance(YDR135c-A63) so that its level of tolerance was only slightly inferior to that of the wild strain. By contrast, mutant yeast expressing OsHMA3mc did not grow at 30 μM CdCl2(YDR135c-A63-CKK), indicating that OsHMA3mc had no effect on Cd sensitivity in YDR135c[2](Fig 2).


Structured Information

Gene Name

Os07g0232900

Description

ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter family protein

Version

NM_001065775.2 GI:297606939 GeneID:4342783

Length

3809 bp

Definition

Oryza sativa Japonica Group Os07g0232900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:7437901..7441709

Sequence Coding Region

7437901..7439339,7439452..7439657,7439841..7440171,7440268..7440405,7440619..7440874
,7440963..7441318,7441421..7441709

Expression

GEO Profiles:Os07g0232900

Genome Context

<gbrowseImage1> name=NC_008400:7437901..7441709 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:7437901..7441709 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggaaaggatgaggcggaagggctcgaggcgaggctgctgctgctgccgcctgaggcggcggcggaggagccgacgaggtgtggcggcggcgacggcggcggcggcgggaggaagcggaagaagacgtaccttgatgtccttggcgtgtgctgctccgcggaggtcgcgctggtggagcggctgctcgcgccgctcgacggcgtccgcgtggtgtccgtcgtcgtggcgtcccgcaccgtcgtcgtcgagcacgaccccgccgccgccccggagtccgccatcgtgaaggcgctgaacaaggccggcctcgaggcgtcggtgcgagcctacggcagcagcggcgtggtcagccggtggccgagcccgtacatcgtcgcctccggcgtcctcctcacggcgtccttcttcgagtggctcttccctcccctgcagtgcctggccgtggcggccgtcgtcgccggcgcgccgccgatggtgcgccgtgggttcgccgcggcgagccggctgtcgctcgacatcaacgtcctcatgctcatcgccgtcgccggcgcgctctgcctcggcgactacacggaggccggcgccatcgtcttcctcttcaccaccgcagaatggctcgagacgctggcctgcacaaaggcgagcgccgggatgtcgtcgttgatgggcatgctgccggtgaaggcggtcatcgcgacgacgggcgaggttgtcagcgtgcgcgacgtccgcgtgggcgacgtcgtcgcggtcagggccggcgagatcgtccccgtcgacggcgtggtggtcgacggccagagcgaggtcgacgagaggagcctcaccggcgagtccttcccggtgccgaagcagccgcactccgaggtctgggccggcacaatgaactttgacggttacattgctgtgagaactacggctctcgccgagaactcgacggtggcgaagatggagaggctggtggaggcggcgcagaacagcaggtcgaagacgcagcggctgatcgattcgtgcgcaaagtactacacgccggccgtggtggttgttgcagcaggagtggccctgatcccggctctgctcggagcagatggccttgagcaatggtggaagctggctctggtgatgcttgtgagcgcgtgcccctgcgcattagtgctgtcgacaccggtggcatccttctgcgcaatgctgcgcgctgcgaggatggggatcttcatcaagggtggagatgttcttgaatcacttggggagatcagggccgtcgcgttcgacaagaccgggacgatcaccagaggagagttcagcatcgactcgttccatctggttggggatcacaaggttgagatggatcatcttctttactggattgcaagcattgagagcaagtcaagccacccaatggcagctgcacttgtggagtatgctcaatccaaatccatccaaccaaacccggaaaatgtgggcgattttcggatatatcccggggaggggatctatggagagatccatggaaagcacatctacattgggaacagaaggacattggcaagagcgtcatcacctcagtcaactcaagaaatgggtgagatgatcaagggcgtgtcgatcggctacgtgatctgcgacggcgagctcgccggcgtcttctcgctctccgacgactgccggaccggcgcggcggaggcgatccgggagcttggatcgctgggcatcaagtcggttatgctgaccggggacagcagcgcggcggcgacgcacgcgcagggccagctcggcggcgtcatggaggagctccactccgagctcctcccggaggacaaggtccggctcgtcagcggcctcaaggcgaggttcggcccgacgatgatggtcggggacgggatgaacgacgcggcggcgctggcggcggcggacgtgggcgtgtccatgggcatctccgggtcggcggcggcgatggagaccagccacgcgacgctcatgtcgagcgacgtgctcagggtccccgaggccgtcaggctcggccggtgcgcccgccggaccatcgccgtcaacgtggccggctcggtggccgtgaaggccgccgtgctcgcgctggccgcggcgtggcgccccgtgctctgggccgccgtgctcgccgacgtcgggacgtgcctcctcgtcgtgctcaacagcatgacgctgctcagggaggagtggaagggcggcgccaaggaggacggcgcgtgccgcgccacggcgaggtcgctggtgatgaggtcccagctcgccgccgactcccaagcacccaacgccgcagacgctggcgccgccggccgtgagcaaacgaacggctgccgttgctgtccgaagccgggcatgtcgcccgagcactcggttgtcatcgacatccgagccgacggcgagcgtcaagaagagcggccggccgaggcggccgtcgttgccaaatgttgcggcggaggcggcggcgagggcatccgctgcggagcctccaagaagccaactgcaacggtcgttgttgccaaatgttgcgggggcggcggcggcggcgagggcaccaggtgcggcgcgtccaagaatccggcaacggcggccgtcgttgccaaatgttgcagcggaggcggcggcgagggcatcggctgcggagcctccaagaagccaactgcaacggccgttgttgccaaatgttgcggcggcggcggcgagggcaccaggtgcgccgcgtccaagaagccggcaacggcggccgtcgttgccaaatgttgcggtggcgatggcggcgagggcaccggatgtggtgcctccaagaggtcgccgccggctgagggaagctgcagcggcggtgaaggcggtaccaatggtgttggtcgttgctgcacgagcgtgaagaggccaacctgttgcgacatgggagcggcggaggtgtccgattcttcgccggagacggcgaaagactgcagaaatgggaggtgttgcgcgaagacgatgaactccggtgaagtgaaaggatga</cdnaseq>

Protein Sequence

<aaseq>MAGKDEAEGLEARLLLLPPEAAAEEPTRCGGGDGGGGGRKRKKT YLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALNK AGLEASVRAYGSSGVVSRWPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPM VRRGFAAASRLSLDINVLMLIAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASA GMSSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERS LTGESFPVPKQPHSEVWAGTMNFDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQ RLIDSCAKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSACPCALVLSTPV ASFCAMLRAARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVE MDHLLYWIASIESKSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKH IYIGNRRTLARASSPQSTQEMGEMIKGVSIGYVICDGELAGVFSLSDDCRTGAAEAIR ELGSLGIKSVMLTGDSSAAATHAQGQLGGVMEELHSELLPEDKVRLVSGLKARFGPTM MVGDGMNDAAALAAADVGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRCARRT IAVNVAGSVAVKAAVLALAAAWRPVLWAAVLADVGTCLLVVLNSMTLLREEWKGGAKE DGACRATARSLVMRSQLAADSQAPNAADAGAAGREQTNGCRCCPKPGMSPEHSVVIDI RADGERQEERPAEAAVVAKCCGGGGGEGIRCGASKKPTATVVVAKCCGGGGGGEGTRC GASKNPATAAVVAKCCSGGGGEGIGCGASKKPTATAVVAKCCGGGGEGTRCAASKKPA TAAVVAKCCGGDGGEGTGCGASKRSPPAEGSCSGGEGGTNGVGRCCTSVKRPTCCDMG AAEVSDSSPETAKDCRNGRCCAKTMNSGEVKG</aaseq>

Gene Sequence

<dnaseqindica>2371..3809#2053..2258#1539..1869#1305..1442#836..1091#392..747#1..289#atggccggaaaggatgaggcggaagggctcgaggcgaggctgctgctgctgccgcctgaggcggcggcggaggagccgacgaggtgtggcggcggcgacggcggcggcggcgggaggaagcggaagaagacgtaccttgatgtccttggcgtgtgctgctccgcggaggtcgcgctggtggagcggctgctcgcgccgctcgacggcgtccgcgtggtgtccgtcgtcgtggcgtcccgcaccgtcgtcgtcgagcacgaccccgccgccgccccggagtccgccatcggtaagccaccgcgcgcgcgcgcgccattaatcctccacgcgattctcgcgcgagattctcactgaatcgagtcgtcgtcgtcgtctttgtcttggagtgcagtgaaggcgctgaacaaggccggcctcgaggcgtcggtgcgagcctacggcagcagcggcgtggtcagccggtggccgagcccgtacatcgtcgcctccggcgtcctcctcacggcgtccttcttcgagtggctcttccctcccctgcagtgcctggccgtggcggccgtcgtcgccggcgcgccgccgatggtgcgccgtgggttcgccgcggcgagccggctgtcgctcgacatcaacgtcctcatgctcatcgccgtcgccggcgcgctctgcctcggcgactacacggaggccggcgccatcgtcttcctcttcaccaccgcagaatggctcgagacgctggcctgcacaaaggtaggagtacatgtcaatgtcctcttcaccaaatccatggcgatcttggcacgaacccggacgaacactcacgttgcgaggtgtgcaggcgagcgccgggatgtcgtcgttgatgggcatgctgccggtgaaggcggtcatcgcgacgacgggcgaggttgtcagcgtgcgcgacgtccgcgtgggcgacgtcgtcgcggtcagggccggcgagatcgtccccgtcgacggcgtggtggtcgacggccagagcgaggtcgacgagaggagcctcaccggcgagtccttcccggtgccgaagcagccgcactccgaggtctgggccggcacaatgaactttgacggtaaacaaacaaacaatcaaaaaaatctctcatctcttagtttcagagttcccaaatgtacggaactctgaaacgtccgtgtcgttgaattgtccgtcttttctcatcagcttaagttctggtaaactgattgacgcatccaactcaatagtcacaatagcacacatttgttcatgtcatgatcaatgggattgagaggctgtcacgtttcaggttacattgctgtgagaactacggctctcgccgagaactcgacggtggcgaagatggagaggctggtggaggcggcgcagaacagcaggtcgaagacgcagcggctgatcgattcgtgcgcaaagtactacacgccgggtgcgcaatcggcatcgcctaaactctcaacatctccaattttacaacacaaaattcatcagtaacaaagacatttctgttcttggtgcgttgcagccgtggtggttgttgcagcaggagtggccctgatcccggctctgctcggagcagatggccttgagcaatggtggaagctggctctggtgatgcttgtgagcgcgtgcccctgcgcattagtgctgtcgacaccggtggcatccttctgcgcaatgctgcgcgctgcgaggatggggatcttcatcaagggtggagatgttcttgaatcacttggggagatcagggccgtcgcgttcgacaagaccgggacgatcaccagaggagagttcagcatcgactcgttccatctggttggggatcacaaggttgagatggatcatcttctttactggtaagactgagaaagaagatttcatttcagctcttggaatgcagctgctacactgaacaaatttgacagattttcaactgttgtcggtttacgacttgtcgaaaaatccttagtacttgtgatggtttgaattgacttgaacagtgaaatgcttggcacaaattatgtctttggttattgcaggattgcaagcattgagagcaagtcaagccacccaatggcagctgcacttgtggagtatgctcaatccaaatccatccaaccaaacccggaaaatgtgggcgattttcggatatatcccggggaggggatctatggagagatccatggaaagcacatctacattgggaacagaaggacattggcaagagcgtcatcacctcagtcaagtgagcaaaacacatcatttgtagtagtagtacagttcctgacaattaagcttcagaattagctgatcagctgaagctgagctgactgaactgaaatctgtgacgtttacagctcaagaaatgggtgagatgatcaagggcgtgtcgatcggctacgtgatctgcgacggcgagctcgccggcgtcttctcgctctccgacgactgccggaccggcgcggcggaggcgatccgggagcttggatcgctgggcatcaagtcggttatgctgaccggggacagcagcgcggcggcgacgcacgcgcagggccagctcggcggcgtcatggaggagctccactccgagctcctcccggaggacaaggtccggctcgtcagcggcctcaaggcgaggttcggcccgacgatgatggtcggggacgggatgaacgacgcggcggcgctggcggcggcggacgtgggcgtgtccatgggcatctccgggtcggcggcggcgatggagaccagccacgcgacgctcatgtcgagcgacgtgctcagggtccccgaggccgtcaggctcggccggtgcgcccgccggaccatcgccgtcaacgtggccggctcggtggccgtgaaggccgccgtgctcgcgctggccgcggcgtggcgccccgtgctctgggccgccgtgctcgccgacgtcgggacgtgcctcctcgtcgtgctcaacagcatgacgctgctcagggaggagtggaagggcggcgccaaggaggacggcgcgtgccgcgccacggcgaggtcgctggtgatgaggtcccagctcgccgccgactcccaagcacccaacgccgcagacgctggcgccgccggccgtgagcaaacgaacggctgccgttgctgtccgaagccgggcatgtcgcccgagcactcggttgtcatcgacatccgagccgacggcgagcgtcaagaagagcggccggccgaggcggccgtcgttgccaaatgttgcggcggaggcggcggcgagggcatccgctgcggagcctccaagaagccaactgcaacggtcgttgttgccaaatgttgcgggggcggcggcggcggcgagggcaccaggtgcggcgcgtccaagaatccggcaacggcggccgtcgttgccaaatgttgcagcggaggcggcggcgagggcatcggctgcggagcctccaagaagccaactgcaacggccgttgttgccaaatgttgcggcggcggcggcgagggcaccaggtgcgccgcgtccaagaagccggcaacggcggccgtcgttgccaaatgttgcggtggcgatggcggcgagggcaccggatgtggtgcctccaagaggtcgccgccggctgagggaagctgcagcggcggtgaaggcggtaccaatggtgttggtcgttgctgcacgagcgtgaagaggccaacctgttgcgacatgggagcggcggaggtgtccgattcttcgccggagacggcgaaagactgcagaaatgggaggtgttgcgcgaagacgatgaactccggtgaagtgaaaggatga</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0232900, RefSeq:Os07g0232900

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 3.4 3.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 4.2 4.3 4.4 4.5 4.6 Cite error: Invalid <ref> tag; no text was provided for refs named ref4