Os12g0555500
PBZ1, a PR10 family protein, has been shown to accumulate in tissues undergoing cell death/programmed cell death (PCD) in rice, it was first shown to be weakly induced only 3 days after treatment with a herbicide, probenazol.
Contents
Annotated Information
Function
PBZ1 gene has an important function during the disease resistance response in rice[1]. Numerous reports and researchers have hypothesized it as a molecular marker in rice self-defense, but the precise function of PBZ1 remains unknown[2][3][4]. In recent years, Sun et al. have demonstrated that the expression levels and localizations of PBZ1 dramatically coincided with tissues undergoing programmed cell death(PCD), namely, during leaf senescence, root aerenchyma formation, coleoptiles senescence, root cap, and seed aleurone layer[2].
- Naoki et al. have showed that the time course of the accumulation of the PBZl mRNA after treatment with probenazole corresponds to that of the development of anti-rice blast activity, this gene is somewhat related to disease resistance, and it is not a simple nonspecific response to chemical stimulation[1].
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- Environmental Biotechnology National Core Research Center, Gyeongsang National University, Jinju 660-701, Korea
- Department of Plant Bioscience, Pusan National University, Busan 609-735, Korea
- United Graduate School, Tokyo Uni_ersity of Agriculture and Technology, Tokyo, Japan
- Food Function Laboratory, Ibaraki Uni_ersity, Ami, Ibaraki, Japan
- National Institute of Agricultural Biotechnology,Rural Development Administration,Suwon 440-707, South Korea
- Pharmaceutical Research Center, Meiji Seika Kaisha, Ltd., Morooka-cho, Kohoku-ku, Yokohama, 222 Japan
References
Please input cited references here.
Structured Information
| Gene Name |
Os12g0555500 |
|---|---|
| Description |
Probenazole-inducible protein PBZ1 |
| Version |
NM_001073530.1 GI:115489021 GeneID:4352491 |
| Length |
1152 bp |
| Definition |
Oryza sativa Japonica Group Os12g0555500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 12:22803752..22804903 |
| Sequence Coding Region |
22803834..22804008,22804330..22804631 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008405:22803752..22804903 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008405:22803752..22804903 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctccggcctgcgtctccgacgagcacgccgtcgcggtgtcggcggagcggctgtggaaggcgttcatggacgcgtccactttgcccaaggcctgcgccggcttggtcgacgacattgcggtcgaggggaacggtggtccgggcaccatctacaccatgaagcttaaccctgccgcgggtgtgggaagcacatacaagacccgggtggcggtgtgcgacgccgcaagtcatgtcctaaagtcggatgtgctcgaggcagaaagcaaggtggggaagctcaagtcacactcgacggagacgaagcttgaggccaccggcgatggctcctgtgtggccaagctcaaggtggagtacgagctcgaggacggcagctcactgtcgccggagaaggagaaggacatcgtggatggctactatggcatgctcaagatgatcgaggactacctcgtcgctcaccctgccgaatacgcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAPACVSDEHAVAVSAERLWKAFMDASTLPKACAGLVDDIAVEG NGGPGTIYTMKLNPAAGVGSTYKTRVAVCDAASHVLKSDVLEAESKVGKLKSHSTETK LEATGDGSCVAKLKVEYELEDGSSLSPEKEKDIVDGYYGMLKMIEDYLVAHPAEYA</aaseq> |
| Gene Sequence |
<dnaseqindica>83..257#579..880#cagctctagctagctacaggcatcagtggtcagtagagtgatcagttgcaactagctagctagttagattatatcttcagtgatggctccggcctgcgtctccgacgagcacgccgtcgcggtgtcggcggagcggctgtggaaggcgttcatggacgcgtccactttgcccaaggcctgcgccggcttggtcgacgacattgcggtcgaggggaacggtggtccgggcaccatctacaccatgaagcttaaccctggtaggtccagaaagatctaagtacttgtatctactgattgtacttattatctcggccgattttttttcttaaatttttgtgaatttggtcaaaatttagtcaaattcagttaaattattttcaaatttctgaaaaaaaaatcagtccaaaaagtgccgaaaatcccgaaattttggttctaccaaaatggctttcggcgaaatcgaaagtgaaaatcctgtcaacaacaaaaagaatttgattaagacagttaaaattactatagtgcagtataaaattgattgggtatataataacaacaaatgttaaaattatatgcagccgcgggtgtgggaagcacatacaagacccgggtggcggtgtgcgacgccgcaagtcatgtcctaaagtcggatgtgctcgaggcagaaagcaaggtggggaagctcaagtcacactcgacggagacgaagcttgaggccaccggcgatggctcctgtgtggccaagctcaaggtggagtacgagctcgaggacggcagctcactgtcgccggagaaggagaaggacatcgtggatggctactatggcatgctcaagatgatcgaggactacctcgtcgctcaccctgccgaatacgcctaagatgaagaggaatactgcctctatccagtatatcccacctagagtgagtgataattaaataatgagagccgcagaaatgtccaaattctcgtggcgtttgagtccgtgagagtaatttcgtgctttaagtttgtggttgtgtttatgtgcctttctatggtcgtattcagtgttaaagttatcattttgcttcatcaatgggtgaataaagagaggcaagtctgaatgtgttctgctatggtttggaggttaatatggaagattgaaaatca</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4
