Os08g0174500

From RiceWiki
Revision as of 08:32, 17 September 2013 by Xysj2012 (talk | contribs) (Wild Type & Mutants)
Jump to: navigation, search

The rice Os08g0174500 is a major QTL located at chromosome 8 of rice with pleiotropic effects on grain yield, heading date, and plant height[1][2][3]. It was reported as DTH8, Ghd8 and LHD1 in 2010, 2011 and 2012, espectively[1][2][3].

Annotated Information

Figure 1. Phenotypes of Asominori and chromosome segment substitution line of OsDTH8(CSSL61). The left is Asominori and right is CSSL61 (from reference[1]).

Function

  • Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). OsDTH8 is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as Ehd1, Hd3a and RFT1[1][2][3].

  • OsDTH8 can also influence plant height and yield potential by the regulation of stem growth and panicle development [1][2][3]. It was considerd that OsDTH8 could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential[2].

GO assignment(s): GO:0003677, GO:0005622, GO:0005634, GO:0043565

Wild Type & Mutants

Figure 2. Transformants (left) VS. wild-type (right)(from reference[2]).


  • The population genetics analysis made by Xiangjin Wei et al. in 2010 showed that the chromosome segment substitution lines of OsDTH8 under the Asominori genetic background (Japonica) diplayed earlier heading than Asominori. Their plant height, number of grains per panicle, yield, and dry weight per plant decreased significantly in compared with Asominori NLD condition (Figure 1)[1].

  • The transgenetic analysis in rice made by Wen-Hao Yan et al. showed that the positive T1 plants of OsDTH8 could produce more grains. They displayed significantly delayed heading with taller culms compared to the transgenic negative plants. On the whole, a positive T1 plant resulted in an increases 60% in grain yield per plant and grains per panicle compared to the control group[2].

  • The transgenetic analysis in Arabidopsis by Wen-Hao Yan et al. showed that transformants of OsDTH8 can bloom about 10 days earlier than the wild-type under LD conditions, however, no obvious difference was observed between the transformants and wild-type under SD conditions (Figure 2)[2].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os08g0174500

Description

Similar to HAP3

Version

NM_001067642.1 GI:115475020 GeneID:4344784

Length

1640 bp

Definition

Oryza sativa Japonica Group Os08g0174500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:4332728..4334367

Sequence Coding Region

4332849..4333742

Expression

GEO Profiles:Os08g0174500

Genome Context

<gbrowseImage1> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:4332728..4334367 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattag</cdnaseq>

Protein Sequence

<aaseq>MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYV VYGGGGGGDSPAKEQDRFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVT GEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAG GAAAARHGEGGCCGGGGGGADGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGG DAGVGYNAGAGSTTTAFYAPAATAASGNKAYCGGDGSRVMEFEGIGGEEESGGGGGGG ERGFAGHLHGVQWFRLKRNTN</aaseq>

Gene Sequence

<dnaseqindica>626..1519#tcggtcattagtatatgttagtataaattaaataattaaacaccttaaacaatattttttcgtcgtagtttgatcatcacctaagattttttagtcttttcaaaatgatcatcagctaacaagtgtatctttatttatttgtgcaagaagtaaatgagcatcattgaatgcgctgcacacatgtaatgcaaacaaccaagttaatttttattggtgcaacggcgcgcactatttaaaacgtgacgcaatgcagcgatagagcaccttgatagataagaattaatttcagcatgatgtagattttgttatccttaatctctactcactttgcataggtaataaattaaaccgctgaactattactacatggtttacatgaaaggtgatcgggtagggacgagaatgtcgcgacacacataatatatatagtagcgtccttatgtttgctttgtgtccgcatcgataccgtcttcccactcgcatctcctcacctcctttccttctttaaaaggagagcatcaccactccatcctcaactcccataacctcccccttctctctctctctaactacacactctctctctagctagctagctagctatagctagtgttgttagcttcacatgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattagctagctaggcacacgcgtagttttattattacttaattaccgcgttaattaattgttgatgctgatgctgtttaaaattgattctccttttgcatgaaatgtttgatggtatggtttaaaa</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0174500, RefSeq:Os08g0174500

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 3.2 3.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref3